Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34760 169 / 7e-56 SAUR-like auxin-responsive protein family (.1) AT1G75580 163 / 9e-54 SAUR-like auxin-responsive protein family (.1) AT2G16580 154 / 4e-50 SAUR-like auxin-responsive protein family (.1) AT2G21220 153 / 7e-50 SAUR-like auxin-responsive protein family (.1) AT1G19830 148 / 1e-47 SAUR-like auxin-responsive protein family (.1) AT4G38860 146 / 4e-47 SAUR-like auxin-responsive protein family (.1) AT4G36110 139 / 2e-44 SAUR-like auxin-responsive protein family (.1) AT2G18010 135 / 8e-43 SAUR-like auxin-responsive protein family (.1) AT5G66260 110 / 6e-33 SAUR-like auxin-responsive protein family (.1) AT4G34810 91 / 3e-25 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012189 [exp] 220 / 4e-76 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 158 / 2e-51 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 154 / 1e-49 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 149 / 8e-48 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 147 / 3e-47 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 130 / 1e-40 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 128 / 9e-40 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 126 / 9e-39 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 100 / 3e-28 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126000 [exp] 171 / 6e-57 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 167 / 2e-55 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 150 / 1e-48 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 147 / 3e-47 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 146 / 5e-47 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 98 / 8e-28 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 91 / 2e-25 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 91 / 5e-25 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 88 / 4e-24 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 88 / 5e-24 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10007553 pacid=23148083 polypeptide=Lus10007553 locus=Lus10007553.g ID=Lus10007553.BGIv1.0 annot-version=v1.0 ATGGGGATCAGGAAGCCAACCAGCAAGCTCTCACAAGCAACAGTGCTGAAGCAGATCCTCAAGAGATGTTCAAGCTTAGGCAAGAACAACAACAACCACA ATCATCAAGAACATTGGTTCCCCCCTGTTGATGTCCCCAAGGGTCACTTTGCAGTTTATGTTGGTGAGAACAGGAGTAGGTACATTGTCCCTATCTCCTT CCTAACCCACCCCGAGTTCCAGTTCCTCCTCAGCAGGGCTGAGGAGGAGTTCGGGTTTGACCACGACATGGGCCTCACCATCCCTTGCGAGGAGGTCGTT TTCCGCTCCCTCACTTCCATGCTCAGATGA
AA sequence Show only first row Show all	>Lus10007553 pacid=23148083 polypeptide=Lus10007553 locus=Lus10007553.g ID=Lus10007553.BGIv1.0 annot-version=v1.0 MGIRKPTSKLSQATVLKQILKRCSSLGKNNNNHNHQEHWFPPVDVPKGHFAVYVGENRSRYIVPISFLTHPEFQFLLSRAEEEFGFDHDMGLTIPCEEVV FRSLTSMLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34760			SAUR-like auxin-responsive pro...		Lus10007553 [exp]	0	1
AT4G34760			SAUR-like auxin-responsive pro...		Lus10012189 [exp]	1.0	0.9201
AT5G14450			GDSL-like Lipase/Acylhydrolase...		Lus10032094 [exp]	1.7	0.9067
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Lus10031354 [exp]	4.0	0.9124
AT1G21460		SWEET1, AtSWEET...	Nodulin MtN3 family protein (....		Lus10018932 [exp]	5.7	0.8863
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Lus10010969 [exp]	11.0	0.8859
AT5G13750		ZIFL1	zinc induced facilitator-like ...		Lus10034794 [exp]	11.1	0.8097
AT1G74160			unknown protein		Lus10017857 [exp]	14.0	0.8402
AT2G21200			SAUR-like auxin-responsive pro...		Lus10008992 [exp]	14.4	0.8350
AT3G52525	OFP	ATOFP6, OFP6	ARABIDOPSIS THALIANA OVATE FAM...		Lus10016978 [exp]	14.5	0.8359
AT2G46500		UBDKGAMMA4, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Lus10003190 [exp]	15.0	0.8380

Compare expression of checked genes

Lus10007553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.