Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 134 / 2e-42 SAUR-like auxin-responsive protein family (.1) AT4G34800 112 / 4e-34 SAUR-like auxin-responsive protein family (.1) AT2G21210 110 / 3e-33 SAUR-like auxin-responsive protein family (.1) AT4G38840 103 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT4G38850 102 / 3e-30 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT3G03820 102 / 8e-30 SAUR-like auxin-responsive protein family (.1) AT4G34810 102 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT5G18080 101 / 1e-29 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18020 101 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT5G18060 100 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012185 [exp] 177 / 2e-59 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 126 / 4e-39 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 112 / 1e-33 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 109 / 8e-33 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 109 / 1e-32 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 108 / 4e-32 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 108 / 5e-32 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 107 / 9e-32 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 106 / 2e-31 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G165800 [exp] 130 / 4e-41 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 115 / 7e-35 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 112 / 7e-34 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 112 / 1e-33 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 109 / 1e-32 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 109 / 1e-32 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 108 / 7e-32 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 107 / 1e-31 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 106 / 2e-31 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 105 / 3e-31 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10007560 pacid=23148110 polypeptide=Lus10007560 locus=Lus10007560.g ID=Lus10007560.BGIv1.0 annot-version=v1.0 ATGGGGATTGCTCAAAATGCAAGGCAAAAGCTACAAAGAACACTATCAGCCAAACTATCTTCTTCTTCTTCCAATGTGCCAAAGGGTCATATTGCAGTCT ACGTTGGTGAAGGCTACACTAAGAAGAAGAGGTTCATCATCCCAGTCACTTACTTGAACCATCCTTTGTTCCAAGTCCTCCTCAATCGAGCTGAGGAAGA GTTCGGGTTTGATCATCCCATGGGTGGACTCACCATCCCCTGCAGCGAGGAGTACTTCGTTAGTCTCACCTCTGCGCTCAGCTGCTAG
AA sequence Show only first row Show all	>Lus10007560 pacid=23148110 polypeptide=Lus10007560 locus=Lus10007560.g ID=Lus10007560.BGIv1.0 annot-version=v1.0 MGIAQNARQKLQRTLSAKLSSSSSNVPKGHIAVYVGEGYTKKKRFIIPVTYLNHPLFQVLLNRAEEEFGFDHPMGGLTIPCSEEYFVSLTSALSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10007560 [exp]	0	1
AT4G35690			Arabidopsis protein of unknown...		Lus10041835 [exp]	1.0	0.9687
AT3G11590			unknown protein		Lus10013311 [exp]	4.2	0.9576
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10033939 [exp]	13.0	0.9571
					Lus10042799 [exp]	18.3	0.9602
AT3G11590			unknown protein		Lus10013312 [exp]	19.5	0.9171
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10017655 [exp]	21.2	0.9505
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012185 [exp]	23.3	0.9596
AT3G04910		ATWNK1, ZIK4, W...	with no lysine (K) kinase 1 (....		Lus10001789 [exp]	24.0	0.8614
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Lus10026147 [exp]	24.1	0.8598
AT2G39180		CCR2, ATCRR2	CRINKLY4 related 2 (.1)		Lus10041404 [exp]	25.2	0.9076

Compare expression of checked genes

Lus10007560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.