Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34810 124 / 6e-38 SAUR-like auxin-responsive protein family (.1) AT4G34800 114 / 3e-34 SAUR-like auxin-responsive protein family (.1) AT2G21210 114 / 5e-34 SAUR-like auxin-responsive protein family (.1) AT4G38840 113 / 8e-34 SAUR-like auxin-responsive protein family (.1) AT5G18020 104 / 1e-30 SAUR-like auxin-responsive protein family (.1) AT4G34770 104 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT5G18030 103 / 5e-30 SAUR-like auxin-responsive protein family (.1) AT5G18080 102 / 8e-30 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18010 102 / 2e-29 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT4G34790 101 / 4e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012184 [exp] 184 / 2e-61 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 164 / 5e-54 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 162 / 2e-53 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10042377 [exp] 144 / 5e-46 AT4G34810 120 / 6e-37 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 105 / 8e-31 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 103 / 5e-30 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 103 / 1e-29 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 102 / 2e-29 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 101 / 5e-29 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G127500 [exp] 124 / 4e-38 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 122 / 2e-37 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 116 / 5e-35 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 113 / 6e-34 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 113 / 7e-34 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 114 / 1e-33 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 111 / 3e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 111 / 4e-33 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 110 / 6e-33 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G166300 [exp] 108 / 1e-31 AT5G18020 113 / 6e-34 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10007561 pacid=23148126 polypeptide=Lus10007561 locus=Lus10007561.g ID=Lus10007561.BGIv1.0 annot-version=v1.0 ATGGGTATCGGCCGATTCGCGACGACAGTGATGAATGTCAAGCACAAGATCAAAGGGAAGTCCCTAATCCACCATCACCAAAGCATTGACCAAAGTACTA GCACTAGTAGTCATCTAAGTGTACCAAAGGGGCATGTTGCAGTCTATGTCGGAGAAGAGACGGAGATGATGATGAAGAGATTTGTGGTGCCCATCTCTTA CTTGAGCCACCCTTCATTCCAAGACTTGCTTAGGAAAGCTGAGGAAGAGTTCGGTTTCGACCACCCGATGGGTGGACTCACTATCCCTTGTCGAGAGGAT GCTTTCGTTGACCTCATCGCCTCTCATCACTTACATCATTCATCATCGTGA
AA sequence Show only first row Show all	>Lus10007561 pacid=23148126 polypeptide=Lus10007561 locus=Lus10007561.g ID=Lus10007561.BGIv1.0 annot-version=v1.0 MGIGRFATTVMNVKHKIKGKSLIHHHQSIDQSTSTSSHLSVPKGHVAVYVGEETEMMMKRFVVPISYLSHPSFQDLLRKAEEEFGFDHPMGGLTIPCRED AFVDLIASHHLHHSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34810			SAUR-like auxin-responsive pro...		Lus10007561 [exp]	0	1
AT4G34810			SAUR-like auxin-responsive pro...		Lus10012184 [exp]	1.0	0.9910
AT1G17710		AtPEPC1	Arabidopsis thaliana phosphoet...		Lus10037652 [exp]	12.8	0.9593
AT5G26830			Threonyl-tRNA synthetase (.1)		Lus10030843 [exp]	16.4	0.9903
AT2G04220			Plant protein of unknown funct...		Lus10043317 [exp]	19.7	0.9899
					Lus10042799 [exp]	22.2	0.9862
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10030842 [exp]	23.4	0.9874
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	26.4	0.9871
AT1G06260			Cysteine proteinases superfami...		Lus10002184 [exp]	28.8	0.9870
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10023114 [exp]	30.7	0.9869
AT3G44540		FAR4	fatty acid reductase 4 (.1.2)		Lus10019187 [exp]	33.3	0.9867

Compare expression of checked genes

Lus10007561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.