Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34800 91 / 3e-25 SAUR-like auxin-responsive protein family (.1) AT4G34810 90 / 2e-24 SAUR-like auxin-responsive protein family (.1) AT4G34770 89 / 2e-24 SAUR-like auxin-responsive protein family (.1) AT4G34790 85 / 2e-22 SAUR-like auxin-responsive protein family (.1) AT4G34780 82 / 3e-21 SAUR-like auxin-responsive protein family (.1) AT2G21210 81 / 3e-21 SAUR-like auxin-responsive protein family (.1) AT5G18050 80 / 9e-21 SAUR-like auxin-responsive protein family (.1) AT4G38840 80 / 1e-20 SAUR-like auxin-responsive protein family (.1) AT4G38850 79 / 2e-20 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT2G21200 76 / 4e-19 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012181 [exp] 184 / 2e-61 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1) Lus10042379 [exp] 98 / 2e-27 AT4G34810 98 / 2e-27 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 91 / 9e-25 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 90 / 3e-24 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 89 / 4e-24 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 89 / 4e-24 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 88 / 6e-24 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 87 / 2e-23 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 87 / 2e-23 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G166300 [exp] 94 / 4e-26 AT5G18020 113 / 6e-34 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 93 / 2e-25 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 91 / 4e-25 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 90 / 1e-24 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 89 / 3e-24 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 88 / 7e-24 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 87 / 2e-23 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 87 / 2e-23 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 83 / 4e-22 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 84 / 5e-22 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10007564 pacid=23148064 polypeptide=Lus10007564 locus=Lus10007564.g ID=Lus10007564.BGIv1.0 annot-version=v1.0 ATGGGGATTCTTCACTTGCCATCGTCTGTCATTTCAGGAGCCAAACAGATCCTCAAGAGACAACCTTCTTTGTCATCATCTACATCGTCGACATCTTATT CATCTCGAAGAAGAAGCAGGAGGAGCGTTCCAAAGGGCCACATTGCGGTCTACGTAGGAGAAGGAGAAGTCGACGATAGGAAAAGATTCGTGGTCCCGAT TTCGGTACTCAACCATCCTTTGTTCCTCGACTTGCTTAAACTAGCTGAGGACGAGTTCGGATACTACCCTCCCCGTGGAGCCCTGACGATCCCTTGCCAC GAGGATGAATTCGTCGACCTCCTCGTCGCTTCTTCCTTGCTGTATACATTGTAA
AA sequence Show only first row Show all	>Lus10007564 pacid=23148064 polypeptide=Lus10007564 locus=Lus10007564.g ID=Lus10007564.BGIv1.0 annot-version=v1.0 MGILHLPSSVISGAKQILKRQPSLSSSTSSTSYSSRRRSRRSVPKGHIAVYVGEGEVDDRKRFVVPISVLNHPLFLDLLKLAEDEFGYYPPRGALTIPCH EDEFVDLLVASSLLYTL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34770			SAUR-like auxin-responsive pro...		Lus10007564 [exp]	0	1
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10031607 [exp]	7.7	0.9366
AT5G60330			unknown protein		Lus10018274 [exp]	12.0	0.9365
AT5G58610			PHD finger transcription facto...		Lus10018681 [exp]	12.2	0.8759
AT1G56290			CwfJ-like family protein (.1)		Lus10008172 [exp]	12.9	0.8089
AT1G53903			Protein of unknown function (D...		Lus10003939 [exp]	14.8	0.9307
AT5G49340		TBL4	TRICHOME BIREFRINGENCE-LIKE 4 ...		Lus10037726 [exp]	15.1	0.9330
AT3G59510			Leucine-rich repeat (LRR) fami...		Lus10027040 [exp]	17.6	0.8187
AT3G12160		AtRABA4d	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10016284 [exp]	18.7	0.9306
AT4G03010			RNI-like superfamily protein (...		Lus10033744 [exp]	19.7	0.9300
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036818 [exp]	20.4	0.9193

Compare expression of checked genes

Lus10007564 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.