Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02480 44 / 9e-08 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012179 [exp] 63 / 3e-15 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 55 / 7e-12 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10027298 [exp] 53 / 4e-11 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034081 [exp] 52 / 5e-11 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10039004 [exp] 49 / 9e-10 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003056 [exp] 45 / 5e-08 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034100 [exp] 40 / 5e-06 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003046 [exp] 35 / 0.0004 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007566 pacid=23148074 polypeptide=Lus10007566 locus=Lus10007566.g ID=Lus10007566.BGIv1.0 annot-version=v1.0 ATGATGAACAACTCCCAGGACGCAAGCTACCAGGCAGGCCAGGCCAAAGGGCAAGCTCAGGAGAAAGCTAGCGGCATGATGGAAAAGGCTAGCAGTGCTG CCCAATCCGCAAAGGAATCCGTTCAAGAGGTTGGTTCTCAAATGCAAGCCAAGGCGTCGGGAGCTGCTGAGGTTGCTAAGGACAAACTCGGGATGAATAA TTAA
AA sequence Show only first row Show all	>Lus10007566 pacid=23148074 polypeptide=Lus10007566 locus=Lus10007566.g ID=Lus10007566.BGIv1.0 annot-version=v1.0 MMNNSQDASYQAGQAKGQAQEKASGMMEKASSAAQSAKESVQEVGSQMQAKASGAAEVAKDKLGMNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53820			Late embryogenesis abundant pr...		Lus10007566 [exp]	0	1
					Lus10003695 [exp]	2.4	1.0000
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	3.7	1.0000
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040724 [exp]	4.6	1.0000
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10008656 [exp]	5.2	0.7997
AT1G23030		PUB11	ARM repeat superfamily protein...		Lus10014900 [exp]	5.3	0.9082
					Lus10020958 [exp]	5.3	1.0000
					Lus10021906 [exp]	5.9	1.0000
AT4G35700	C2H2ZnF	DAZ3	DUO1-activated zinc finger 3, ...		Lus10041633 [exp]	6.5	1.0000
AT4G21020			Late embryogenesis abundant pr...		Lus10014004 [exp]	8.3	0.8151
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10014436 [exp]	8.8	1.0000

Compare expression of checked genes

Lus10007566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.