Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32110 64 / 3e-14 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32080 62 / 2e-13 unknown protein AT4G32090 61 / 3e-13 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32105 59 / 3e-12 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32100 49 / 2e-08 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT1G32583 47 / 1e-07 unknown protein AT4G24972 45 / 1e-06 TPD1 tapetum determinant 1 (.1) AT1G05835 40 / 4e-05 PHD finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012177 [exp] 161 / 5e-53 AT4G32090 66 / 6e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10042384 [exp] 128 / 1e-39 AT4G32110 81 / 1e-20 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10026289 [exp] 121 / 2e-36 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10001911 [exp] 45 / 8e-07 AT1G32583 157 / 5e-50 unknown protein Lus10022437 [exp] 45 / 3e-06 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2) Lus10016744 [exp] 43 / 1e-05 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G167900 [exp] 99 / 8e-28 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.009G129400 [exp] 98 / 1e-27 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.006G257600 [exp] 60 / 1e-12 AT4G32105 77 / 4e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.010G246900 [exp] 53 / 6e-10 AT1G32583 104 / 3e-29 unknown protein Potri.010G246300 [exp] 49 / 3e-08 AT1G32583 85 / 1e-21 unknown protein Potri.006G017600 [exp] 49 / 4e-08 AT1G32583 187 / 5e-61 unknown protein Potri.008G105600 [exp] 47 / 1e-07 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.002G233000 [exp] 46 / 3e-07 AT1G05835 111 / 2e-32 PHD finger protein (.1) Potri.015G101000 [exp] 45 / 1e-06 AT1G32583 157 / 5e-49 unknown protein Potri.012G102900 [exp] 43 / 8e-06 AT1G32583 160 / 2e-50 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007569 pacid=23148092 polypeptide=Lus10007569 locus=Lus10007569.g ID=Lus10007569.BGIv1.0 annot-version=v1.0 ATGTATTGTTGTCATGCAGGGTTGAGCGATTGCGATTTGAACAGCCTGACGATCGGGACGACGAGGAGTGGAAAGATGATCGGAGGTGAGACAATGTGGG ATGTGGCAGTGATCAATAACTGTGAGTGTCCCATTAGCAACTTAGTCCTTTCATGTAAAGGATTTTACACAGTTTGGAAATTGGACTCGTCGAAGTTTAA ACAAATTGAAGACGATAAATGCCTTGTAAATGGTGGAAACCCTATTGCTTCTAAGGACTCAGTCAAGTTTTCTTATGCTTGGGATCCTCCCACTTATCTT TCCCCTGTAAGCCTCTCTGGCAAATGTTCGTAG
AA sequence Show only first row Show all	>Lus10007569 pacid=23148092 polypeptide=Lus10007569 locus=Lus10007569.g ID=Lus10007569.BGIv1.0 annot-version=v1.0 MYCCHAGLSDCDLNSLTIGTTRSGKMIGGETMWDVAVINNCECPISNLVLSCKGFYTVWKLDSSKFKQIEDDKCLVNGGNPIASKDSVKFSYAWDPPTYL SPVSLSGKCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G32110			Beta-1,3-N-Acetylglucosaminylt...		Lus10007569 [exp]	0	1
AT5G24090		ATCHIA	chitinase A (.1)		Lus10037985 [exp]	10.9	0.7452
AT4G12440		APT4	adenine phosphoribosyl transfe...		Lus10032249 [exp]	31.9	0.7521
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004043 [exp]	33.0	0.7268
AT3G56950		SIP2;1, SIP2	small and basic intrinsic prot...		Lus10027275 [exp]	39.7	0.6885
					Lus10031697 [exp]	40.2	0.7153
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10015760 [exp]	48.0	0.7116
AT3G26880			Plant self-incompatibility pro...		Lus10025935 [exp]	50.0	0.6768
					Lus10030114 [exp]	53.1	0.7214
AT3G61920			unknown protein		Lus10002686 [exp]	57.3	0.7147
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Lus10017830 [exp]	61.9	0.6520

Compare expression of checked genes

Lus10007569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.