Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00585 135 / 3e-43 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012175 [exp] 100 / 8e-29 AT4G00585 106 / 1e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G155800 [exp] 145 / 6e-47 AT4G00585 130 / 2e-41 unknown protein Potri.014G079800 [exp] 143 / 3e-46 AT4G00585 131 / 1e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007571 pacid=23148086 polypeptide=Lus10007571 locus=Lus10007571.g ID=Lus10007571.BGIv1.0 annot-version=v1.0 ATGGGCGGAGGAGGCGAGCATGGACACGGGGCCGAAGGCTCCCATGGAGATTTCAGGGGGAAGGTGTGGAGTATGACCGGTGGACCTAATTGCCGCCCTA AGCACTGGCGCCGTAACACTGCCATCGCCATGGTCGGTGTCTTCCTCGTCTGTATCCCCATCGCCATGAAATCCGCCGAGCTCGAACAACGGCCTCATCA GCCAGTTCGTCCAATCCCGTCGCAGCTTTGGTGCAAGAACTTCGGGACCAAAGACTACAACAAAGCTGAATGA
AA sequence Show only first row Show all	>Lus10007571 pacid=23148086 polypeptide=Lus10007571 locus=Lus10007571.g ID=Lus10007571.BGIv1.0 annot-version=v1.0 MGGGGEHGHGAEGSHGDFRGKVWSMTGGPNCRPKHWRRNTAIAMVGVFLVCIPIAMKSAELEQRPHQPVRPIPSQLWCKNFGTKDYNKAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00585			unknown protein		Lus10007571 [exp]	0	1
AT4G16450			unknown protein		Lus10038803 [exp]	1.0	0.8935
AT1G48440			B-cell receptor-associated 31-...		Lus10001080 [exp]	2.0	0.8822
AT1G48440			B-cell receptor-associated 31-...		Lus10040126 [exp]	3.2	0.8503
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10023571 [exp]	4.9	0.8354
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009027 [exp]	6.2	0.8604
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10015954 [exp]	11.0	0.8231
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10027449 [exp]	11.7	0.8407
AT2G03690			coenzyme Q biosynthesis Coq4 f...		Lus10026673 [exp]	13.4	0.8529
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Lus10040887 [exp]	16.4	0.8323
AT1G71780			unknown protein		Lus10016547 [exp]	16.7	0.8337

Compare expression of checked genes

Lus10007571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.