Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012166 [exp] 124 / 2e-35 AT4G38710 159 / 2e-44 glycine-rich protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G130200 [exp] 66 / 5e-14 AT4G38710 192 / 1e-56 glycine-rich protein (.1.2) Potri.004G169100 [exp] 59 / 2e-11 AT4G38710 149 / 1e-40 glycine-rich protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06273 [flax] [poplar] eIF-4B Plant specific eukaryotic initiation factor 4B
Representative CDS sequence Show only first row Show all	>Lus10007580 pacid=23148111 polypeptide=Lus10007580 locus=Lus10007580.g ID=Lus10007580.BGIv1.0 annot-version=v1.0 ATGGCGGCAACTGTTTCATCTCCTTGGTCCAAGCCCGGCGCGTGGGCGCTAGACGCCGAGGAGCACGAGGCCGAACTCCAGCAGCAGGATTCACAACCGA AAGAAGAACCCGCCGATTTCCCATCCCTAGCCGCCGCCGCAGCTGACGCGAAGACGGCGACGAAGAAGAAGAAGAAGAACAAAGGGACAACGATTTCTCT GTCCATGCTCCAGTCTGGAACGTACACTCGGCCCGAATTGAACACCGCCTCGCTCCCACACGGGCCGAGGGAGCGGTCCGGAAGTTATGCCGAGGGAGCC GTTGGGACCGTCTAG
AA sequence Show only first row Show all	>Lus10007580 pacid=23148111 polypeptide=Lus10007580 locus=Lus10007580.g ID=Lus10007580.BGIv1.0 annot-version=v1.0 MAATVSSPWSKPGAWALDAEEHEAELQQQDSQPKEEPADFPSLAAAAADAKTATKKKKKNKGTTISLSMLQSGTYTRPELNTASLPHGPRERSGSYAEGA VGTV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007580 [exp]	0	1
AT1G53240		mMDH1	mitochondrial malate dehydroge...		Lus10017939 [exp]	3.3	0.9325
AT1G34130		STT3B	staurosporin and temperature s...		Lus10017990 [exp]	6.9	0.9147
AT5G63840		PSL5, RSW3	RADIAL SWELLING 3, PRIORITY IN...		Lus10020887 [exp]	8.7	0.9156
AT5G54440		CLUB, AtTRS130	CLUB (.1)		Lus10021681 [exp]	8.8	0.8991
AT5G62190		PRH75	DEAD box RNA helicase (PRH75) ...		Lus10027388 [exp]	11.5	0.8721
AT1G11680		EMB1738, CYP51A...	embryo defective 1738, CYTOCHR...		Lus10001713 [exp]	13.0	0.8981
AT5G66680		DGL1	DEFECTIVE GLYCOSYLATION, dolic...		Lus10026039 [exp]	13.6	0.9111
AT5G64290		DCT, DIT2.1	dicarboxylate transport 2.1 (....		Lus10003967 [exp]	13.7	0.8837
AT4G00740		QUA3	QUASIMODO 3, S-adenosyl-L-meth...		Lus10000808 [exp]	14.0	0.8900
AT1G34130		STT3B	staurosporin and temperature s...		Lus10041985 [exp]	16.1	0.9020

Compare expression of checked genes

Lus10007580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.