Lus10007581 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012166 122 / 4e-35 AT4G38710 159 / 2e-44 glycine-rich protein (.1.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007581 pacid=23148107 polypeptide=Lus10007581 locus=Lus10007581.g ID=Lus10007581.BGIv1.0 annot-version=v1.0
ATGAAGATGAAAGGTGGAGAGGATGATAAAGTGGAAAGAGCCGATAAGGGTTCGAGATGGAGCTTTGGCCGTGTTGGTGCTGAAGAAGTTGTGGAGAAGA
GCTGGAGAAAGGCTGTTGATTCTGTCGATGAAAGTTCTGAAGCTGTCGAGAATGGACACCCCGATTCCACCTCGCAGGTTGAAGCTGCCAAGCCAGATGA
GAACGGTGACGCCGCTGCTAACCCGGATAAGAACGGTGAGGCTCTCGCTGCTGCCGTGGAGAATTGA
AA sequence
>Lus10007581 pacid=23148107 polypeptide=Lus10007581 locus=Lus10007581.g ID=Lus10007581.BGIv1.0 annot-version=v1.0
MKMKGGEDDKVERADKGSRWSFGRVGAEEVVEKSWRKAVDSVDESSEAVENGHPDSTSQVEAAKPDENGDAAANPDKNGEALAAAVEN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007581 0 1
AT1G31830 Amino acid permease family pro... Lus10012153 2.0 0.9181
AT3G59840 unknown protein Lus10030936 4.0 0.8828
AT4G00390 GeBP DNA-binding storekeeper protei... Lus10028550 4.2 0.8767
AT5G58470 TAF15b TBP-associated factor 15B (.1.... Lus10026388 4.2 0.8760
AT4G39840 unknown protein Lus10041688 7.9 0.8752
AT4G02500 ATXT2, XXT2 XYG XYLOSYLTRANSFERASE 2, ARAB... Lus10037516 8.7 0.8767
AT1G73650 Protein of unknown function (D... Lus10031343 8.8 0.8391
AT2G20690 lumazine-binding family protei... Lus10017000 9.4 0.8684
AT3G20970 ATNFU2, NFU4 ARABIDOPSIS THALIANA NFU DOMAI... Lus10043440 13.4 0.7895
AT4G10040 CYTC-2 cytochrome c-2 (.1) Lus10008922 13.5 0.8639

Lus10007581 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.