Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007590 pacid=23148118 polypeptide=Lus10007590 locus=Lus10007590.g ID=Lus10007590.BGIv1.0 annot-version=v1.0 ATGTACTCTGCAATCTCGCACATTCGCAACAGTAGAGCAGCTCTGTCCTCGTTCTCTTCTTCTGCTTCATCTTTGCTCCGTACCCATGGCGGATTCTCCA CATTCTCACCCTTCTCTGCTCCCTCCCCTGCTTCTCCAGATTTGGATAACTTTCATTTTGATTCTTTCAAATGTGGAGCAATAGGTGCAGTTATCGGATG GGGAAACTGGTGGAAGTTAGCAATTGGTCCTTACTTGGATGGAGTTGATTTCTATTGTTTCCGTGCAGGTTCTTGTCCATAG
AA sequence Show only first row Show all	>Lus10007590 pacid=23148118 polypeptide=Lus10007590 locus=Lus10007590.g ID=Lus10007590.BGIv1.0 annot-version=v1.0 MYSAISHIRNSRAALSSFSSSASSLLRTHGGFSTFSPFSAPSPASPDLDNFHFDSFKCGAIGAVIGWGNWWKLAIGPYLDGVDFYCFRAGSCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007590 [exp]	0	1
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	8.7	0.7612
AT4G33590			unknown protein		Lus10036462 [exp]	11.8	0.7338
AT3G11210			SGNH hydrolase-type esterase s...		Lus10027793 [exp]	26.1	0.6970
					Lus10035514 [exp]	29.8	0.6442
AT4G29390			Ribosomal protein S30 family p...		Lus10002508 [exp]	33.2	0.7022
AT5G51750		ATSBT1.3	subtilase 1.3 (.1)		Lus10018720 [exp]	33.2	0.6719
AT4G24440			transcription initiation facto...		Lus10001864 [exp]	35.2	0.6448
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10017777 [exp]	37.7	0.6807
AT3G51150			ATP binding microtubule motor ...		Lus10033920 [exp]	52.6	0.6687
AT1G47670			Transmembrane amino acid trans...		Lus10012281 [exp]	56.4	0.6569

Compare expression of checked genes

Lus10007590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.