Lus10007591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31817 166 / 1e-51 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
ATCG00750 54 / 5e-10 ATCG00750.1, RPS11 ribosomal protein S11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012155 275 / 4e-96 AT1G31817 168 / 2e-51 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G117700 160 / 6e-49 AT1G31817 154 / 2e-44 NUCLEAR FUSION DEFECTIVE 3, Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00411 Ribosomal_S11 Ribosomal protein S11
Representative CDS sequence
>Lus10007591 pacid=23148123 polypeptide=Lus10007591 locus=Lus10007591.g ID=Lus10007591.BGIv1.0 annot-version=v1.0
ATGGACTTAGTGAGGAAAATCATAGATGAAAATGCTCAATTCACTAAGCCCACCACCGAGGGAAACGAAGAGGTTGTCCACATACAGCTGCTGCGAAACA
ACACCTTCGTCACAGTCACAGACCAGAAAGGGAACGCCAAGGTTGGAGGGCTCGAGGCTTCGTCAGGGATGGTGCCCGAGCTCAAAGGAGGGCCTAAGCT
CTCTCGTTACGTTGCTGAGGCAACTTCGGAGCATGTTGGGAGGAAGTCCAGAGAAATGGGGCTTAGATCGGTCGTGATTAAGGTCAACGGGTTTACCTTC
TTCAAGAAGAAGAGGCAAGCAATCATGAGCTTCAAAGAAGGGTTCGGCCACAATATCGCTGCCATCGAGGACACAACGCGCAAGCCACATAATGGTTGCA
GACTGCCGAAGAAGCGCAGGATCTAG
AA sequence
>Lus10007591 pacid=23148123 polypeptide=Lus10007591 locus=Lus10007591.g ID=Lus10007591.BGIv1.0 annot-version=v1.0
MDLVRKIIDENAQFTKPTTEGNEEVVHIQLLRNNTFVTVTDQKGNAKVGGLEASSGMVPELKGGPKLSRYVAEATSEHVGRKSREMGLRSVVIKVNGFTF
FKKKRQAIMSFKEGFGHNIAAIEDTTRKPHNGCRLPKKRRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31817 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ri... Lus10007591 0 1
AT5G64140 RPS28 ribosomal protein S28 (.1) Lus10013543 2.4 0.8203
AT3G18110 EMB1270 embryo defective 1270, Pentatr... Lus10013785 4.0 0.7837
AT5G09510 Ribosomal protein S19 family p... Lus10041168 6.7 0.8153
AT5G46850 unknown protein Lus10040093 9.1 0.7277
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10014426 9.9 0.7858
AT2G45640 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18... Lus10041388 13.0 0.8043
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10022881 14.2 0.8462
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10022692 22.0 0.8106
AT1G57540 unknown protein Lus10035345 22.0 0.8082
AT3G08000 RNA-binding (RRM/RBD/RNP motif... Lus10031534 28.9 0.7794

Lus10007591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.