Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11410 144 / 2e-40 S-locus lectin protein kinase family protein (.1) AT1G11340 137 / 3e-38 S-locus lectin protein kinase family protein (.1) AT4G05200 132 / 2e-36 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G23240 128 / 2e-36 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1) AT4G03230 131 / 4e-36 S-locus lectin protein kinase family protein (.1) AT4G23130 130 / 1e-35 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G23270 129 / 2e-35 CRK19 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) AT4G23290 128 / 2e-35 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT4G11470 129 / 3e-35 CRK31 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1) AT1G61380 128 / 4e-35 SD1-29 S-domain-1 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018402 [exp] 295 / 4e-96 AT1G11340 691 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10024064 [exp] 173 / 9e-51 AT1G11340 735 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10041679 [exp] 168 / 2e-50 AT1G11340 417 / 1e-137 S-locus lectin protein kinase family protein (.1) Lus10025242 [exp] 153 / 4e-48 AT1G11340 162 / 1e-46 S-locus lectin protein kinase family protein (.1) Lus10007604 [exp] 164 / 2e-47 AT1G11340 694 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10005137 [exp] 153 / 2e-47 AT1G11340 225 / 1e-68 S-locus lectin protein kinase family protein (.1) Lus10005053 [exp] 159 / 2e-46 AT1G11410 299 / 1e-90 S-locus lectin protein kinase family protein (.1) Lus10007610 [exp] 156 / 7e-45 AT1G11410 693 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013910 [exp] 155 / 1e-44 AT1G11340 628 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G035850 [exp] 161 / 6e-49 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.011G036600 [exp] 165 / 6e-48 AT1G11340 741 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036466 [exp] 157 / 3e-47 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1) Potri.011G035800 [exp] 162 / 6e-47 AT1G11340 705 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 160 / 2e-46 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036400 [exp] 159 / 5e-46 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028532 [exp] 145 / 4e-45 AT4G23140 205 / 9e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.004G028400 [exp] 144 / 2e-44 AT4G23140 206 / 3e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.004G028300 [exp] 150 / 8e-43 AT1G11340 742 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G039100 [exp] 145 / 4e-41 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10007609 pacid=23140340 polypeptide=Lus10007609 locus=Lus10007609.g ID=Lus10007609.BGIv1.0 annot-version=v1.0 ATGTCACCAGAATATGCAGTGTTTGGAAGATTTTCCGAAAAGTCTGACGTGTTCAGCTTCGGTGTCATTCTGTTGGAGACGGTTACAGGCAAGAAGATCA GTACACTCTATCGAGGAGACGAGAACTTGAGCTTGATAGGCCATGTGTGGGAGCTGTGGAATGAAGACAGAGTGCTGGAGGCGGTGGATTCGTCGATGGA GGGATCATACGATGGCGGGGAAGTGATGAGATGCATCCATATCGGGTTGCTCTGCCTCGAGGAAAACGTCGAAGATCGACCCAATATGCTGACGACTGTT CTGATGTTGAACAGTGCAATGCCGGTTCCTGAACCTAAACAACCTGCATTTACCATCAGAAGCTGCAATGATCATCGGCTGCTCGAAGGAACCGGTGGCG TACCGTGCTCTTTCAACGATGTGACTCTAACCGATATCTCGTCGCGTTGA
AA sequence Show only first row Show all	>Lus10007609 pacid=23140340 polypeptide=Lus10007609 locus=Lus10007609.g ID=Lus10007609.BGIv1.0 annot-version=v1.0 MSPEYAVFGRFSEKSDVFSFGVILLETVTGKKISTLYRGDENLSLIGHVWELWNEDRVLEAVDSSMEGSYDGGEVMRCIHIGLLCLEENVEDRPNMLTTV LMLNSAMPVPEPKQPAFTIRSCNDHRLLEGTGGVPCSFNDVTLTDISSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11410			S-locus lectin protein kinase ...		Lus10007609 [exp]	0	1
AT2G19130			S-locus lectin protein kinase ...		Lus10026391 [exp]	5.3	0.9525
AT4G18930			RNA ligase/cyclic nucleotide p...		Lus10002767 [exp]	8.1	0.9385
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10020714 [exp]	14.1	0.9452
AT4G01250	WRKY	ATWRKY22, WRKY2...	WRKY family transcription fact...		Lus10024676 [exp]	15.8	0.9512
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10041642 [exp]	19.9	0.9287
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10017775 [exp]	23.6	0.9450
AT1G06000			UDP-Glycosyltransferase superf...		Lus10007971 [exp]	28.6	0.9454
AT2G03340	WRKY	WRKY3	WRKY DNA-binding protein 3 (.1...		Lus10000173 [exp]	29.5	0.9396
AT4G02280		ATSUS3, SUS3	sucrose synthase 3 (.1)		Lus10013417 [exp]	34.3	0.9311
AT4G23690			Disease resistance-responsive ...		Lus10032331 [exp]	36.7	0.9434

Compare expression of checked genes

Lus10007609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.