Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61680 49 / 4e-08 ATTPS14 terpene synthase 14 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018392 [exp] 150 / 4e-44 AT1G61680 350 / 1e-113 terpene synthase 14 (.1.2) Lus10035240 [exp] 102 / 9e-27 AT1G61680 372 / 5e-123 terpene synthase 14 (.1.2) Lus10000231 [exp] 67 / 3e-14 AT1G61680 348 / 8e-115 terpene synthase 14 (.1.2) Lus10018280 [exp] 64 / 6e-13 AT5G45170 410 / 1e-136 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10040632 [exp] 54 / 4e-10 AT1G61680 153 / 2e-44 terpene synthase 14 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G030400 [exp] 64 / 3e-13 AT1G61680 466 / 8e-160 terpene synthase 14 (.1.2) Potri.004G030200 [exp] 61 / 4e-12 AT1G61680 465 / 2e-159 terpene synthase 14 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10007621 pacid=23140316 polypeptide=Lus10007621 locus=Lus10007621.g ID=Lus10007621.BGIv1.0 annot-version=v1.0 ATGCAGAATGAGGAGCACAATGGGTATGACGGATCGTACGTGGATTACTACATGAAGGAGCATCCAGAATCGTCTATGTACGACGCAAAGAAGCATGTGA TGGAGATGATTGAGGATACTTGGAAGCAATTCAACGGCGAATGTCTTTCTTCTTCGACAAGGCTTCCATCTTCGTTGAATAGTGTTGCTCAAAACTCGGC GAAAATGGTTTTCTTTATGGAACATGTTGGTGATGATGGTGAAAATCCTTCGAGTCTAGAGGACCATATCAAGTCCATGCTCTTTGAAAGCATACCCATT TAG
AA sequence Show only first row Show all	>Lus10007621 pacid=23140316 polypeptide=Lus10007621 locus=Lus10007621.g ID=Lus10007621.BGIv1.0 annot-version=v1.0 MQNEEHNGYDGSYVDYYMKEHPESSMYDAKKHVMEMIEDTWKQFNGECLSSSTRLPSSLNSVAQNSAKMVFFMEHVGDDGENPSSLEDHIKSMLFESIPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10007621 [exp]	0	1

Compare expression of checked genes

Lus10007621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.