Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11530 122 / 5e-37 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT2G40790 74 / 2e-17 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G56420 73 / 4e-17 Thioredoxin superfamily protein (.1) AT1G45145 69 / 8e-16 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G51030 67 / 2e-15 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT3G08710 66 / 2e-14 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT5G39950 63 / 1e-13 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G19730 61 / 1e-12 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G59730 60 / 2e-12 ATH7 thioredoxin H-type 7 (.1) AT4G04950 61 / 1e-11 AtGRXS17 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018383 [exp] 219 / 8e-75 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10020070 [exp] 144 / 3e-45 AT1G11530 145 / 4e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10022727 [exp] 73 / 4e-17 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 73 / 4e-17 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10024293 [exp] 68 / 2e-15 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 67 / 7e-15 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10012859 [exp] 67 / 8e-15 AT3G08710 134 / 9e-41 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10030505 [exp] 67 / 1e-14 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014277 [exp] 66 / 1e-14 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G031700 [exp] 147 / 1e-46 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 129 / 1e-39 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 74 / 9e-18 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 74 / 1e-17 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.005G232700 [exp] 67 / 2e-15 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 66 / 8e-15 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.011G031100 [exp] 66 / 9e-15 AT1G11530 94 / 9e-26 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.019G062000 [exp] 63 / 2e-13 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 62 / 5e-13 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 64 / 1e-12 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10007630 pacid=23140308 polypeptide=Lus10007630 locus=Lus10007630.g ID=Lus10007630.BGIv1.0 annot-version=v1.0 ATGAACAACCATGGGGAGCAAATCAAGTCAAAGGTCCTAAAGGTTGACTCTTTACAGACATGGGAAGTTTCCATAATCCAAGCTTCCTCCTCCCCTGTGA TTGCGCATTTCACAGCTTCATGGTGTATGCCATCTGTGGCGATGAGCCCAGTGTTTGAAGAGCTCTCTTTGGCTTACCCAGATTCCGTTTTCCTCTCTGT GGATGTCGATGATGTTAAGGAAGTGGCTGCTAAGCTAGAGGTGAAAGCCATGCCTACTTTTGTACTGATGAAAGATGGAGCTCAGGGTGACAAGCTCGTC GGAGCTAATCCTGATGAGATCAGGAAAAGGGTCCACAGCTTTATTCAAACGTCTTCTTCTTCCTCCTCTCTCCCAACCATTACAGAAGCTGAAGCTCAAG CCTAG
AA sequence Show only first row Show all	>Lus10007630 pacid=23140308 polypeptide=Lus10007630 locus=Lus10007630.g ID=Lus10007630.BGIv1.0 annot-version=v1.0 MNNHGEQIKSKVLKVDSLQTWEVSIIQASSSPVIAHFTASWCMPSVAMSPVFEELSLAYPDSVFLSVDVDDVKEVAAKLEVKAMPTFVLMKDGAQGDKLV GANPDEIRKRVHSFIQTSSSSSSLPTITEAEAQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10007630 [exp]	0	1
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10018383 [exp]	1.0	0.9808
AT1G56140			Leucine-rich repeat transmembr...		Lus10031401 [exp]	2.0	0.9729
AT5G46110		TPT, APE2	triose-phosphate ⁄ phosp...		Lus10037085 [exp]	2.4	0.9716
AT3G60340			alpha/beta-Hydrolases superfam...		Lus10004375 [exp]	3.0	0.9736
AT4G21790		ATTOM1, TOM1	tobamovirus multiplication 1 (...		Lus10018348 [exp]	3.2	0.9716
AT1G47710			Serine protease inhibitor (SER...		Lus10005089 [exp]	4.7	0.9737
AT2G27770			Plant protein of unknown funct...		Lus10014372 [exp]	5.0	0.9575
AT4G09510		A/N-InvI, CINV2	alkaline/neutral invertase I, ...		Lus10009441 [exp]	5.2	0.9567
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10039335 [exp]	6.3	0.9691
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Lus10004222 [exp]	7.4	0.9668

Compare expression of checked genes

Lus10007630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.