Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71691 61 / 1e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT4G28780 61 / 1e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G50400 61 / 2e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT2G23540 61 / 2e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G04290 61 / 2e-12 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) AT5G33370 60 / 3e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT5G55050 56 / 6e-11 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G18430 56 / 6e-11 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT2G30220 56 / 7e-11 GDSL-like Lipase/Acylhydrolase family protein (.1) AT2G30310 56 / 1e-10 GDSL-like Lipase/Acylhydrolase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037113 [exp] 166 / 6e-52 AT3G04290 192 / 6e-58 Li-tolerant lipase 1 (.1) Lus10036966 [exp] 149 / 3e-45 AT3G04290 198 / 3e-60 Li-tolerant lipase 1 (.1) Lus10037112 [exp] 130 / 3e-38 AT5G55050 176 / 1e-51 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10023980 [exp] 76 / 9e-18 AT5G55050 215 / 1e-66 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10025104 [exp] 74 / 5e-17 AT5G55050 211 / 3e-65 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10023979 [exp] 73 / 1e-16 AT5G55050 229 / 5e-72 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10025105 [exp] 72 / 1e-16 AT5G55050 233 / 2e-73 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10003106 [exp] 68 / 7e-15 AT3G04290 551 / 0.0 Li-tolerant lipase 1 (.1) Lus10026647 [exp] 68 / 7e-15 AT5G55050 159 / 4e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G180400 [exp] 76 / 7e-18 AT4G28780 200 / 4e-61 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G104900 [exp] 68 / 5e-15 AT5G55050 209 / 7e-64 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.007G036300 [exp] 64 / 8e-14 AT2G23540 554 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G024700 [exp] 64 / 2e-13 AT5G33370 549 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.013G051000 [exp] 63 / 2e-13 AT3G04290 543 / 0.0 Li-tolerant lipase 1 (.1) Potri.018G008100 [exp] 63 / 3e-13 AT1G29670 345 / 8e-118 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.007G133766 [exp] 61 / 2e-12 AT3G14225 291 / 4e-96 GDSL-motif lipase 4 (.1) Potri.007G133700 [exp] 61 / 2e-12 AT3G14225 275 / 3e-90 GDSL-motif lipase 4 (.1) Potri.019G024800 [exp] 59 / 5e-12 AT5G33370 544 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.007G133500 [exp] 59 / 5e-12 AT3G14225 296 / 7e-98 GDSL-motif lipase 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007637 pacid=23140292 polypeptide=Lus10007637 locus=Lus10007637.g ID=Lus10007637.BGIv1.0 annot-version=v1.0 ATGGATTTCATCAACCACGGTGCCGTGCATGGTTTGAAAGAGGTGAAAGTCCCGTGTTGCGGAGAAGGAAGCACAGCGTGCAACCAAACATCTACCCTTT GTCGGAATCGCGACGAACATTTGTTTTGGGACGGCTTTCACCCGACCGAGTTCGTCACCAAATTGTCTGCCAGTGCGTTTTTCGGCAATGATTCTAGATT TGTATCTCCTATCGGATTCGGGCAGCTCTGA
AA sequence Show only first row Show all	>Lus10007637 pacid=23140292 polypeptide=Lus10007637 locus=Lus10007637.g ID=Lus10007637.BGIv1.0 annot-version=v1.0 MDFINHGAVHGLKEVKVPCCGEGSTACNQTSTLCRNRDEHLFWDGFHPTEFVTKLSASAFFGNDSRFVSPIGFGQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10007637 [exp]	0	1

Compare expression of checked genes

Lus10007637 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.