Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61780 172 / 1e-57 postsynaptic protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018365 [exp] 201 / 6e-64 AT1G11545 510 / 0.0 xyloglucan endotransglucosylase/hydrolase 8 (.1) Lus10002066 [exp] 95 / 8e-27 AT1G61780 82 / 9e-22 postsynaptic protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G021200 [exp] 181 / 6e-61 AT1G61780 176 / 3e-59 postsynaptic protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10235 [flax] [poplar] Cript Microtubule-associated protein CRIPT
Representative CDS sequence Show only first row Show all	>Lus10007644 pacid=23140325 polypeptide=Lus10007644 locus=Lus10007644.g ID=Lus10007644.BGIv1.0 annot-version=v1.0 ATGGTGTGCGCTAAGTGTGAGAAGAAGCTGGCGAAGGTGATAGTTCCGGACAAGTGGAAGGAAGGAGCTTCCAACACTAACGAAAGCGGCGGCCGGAAGA TCAACGAGAACAAGCTCCTCTCTAAGAAGAACAGATGGACACCTTATGGAGTGACCAAGTGCATGATCTGCAAGCAGCAAGTGCATCAAGATGGCAAGTA CTGCCACACCTGTGCTTATACTAAAGGAGTTTGCGCGATGTGCGGTAAGCAAGTTCTCGACACGAAGATATACAAGCAAAGCAACGTATGA
AA sequence Show only first row Show all	>Lus10007644 pacid=23140325 polypeptide=Lus10007644 locus=Lus10007644.g ID=Lus10007644.BGIv1.0 annot-version=v1.0 MVCAKCEKKLAKVIVPDKWKEGASNTNESGGRKINENKLLSKKNRWTPYGVTKCMICKQQVHQDGKYCHTCAYTKGVCAMCGKQVLDTKIYKQSNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61780			postsynaptic protein-related (...		Lus10007644 [exp]	0	1
AT3G10850		GLY2, GLX2-2	GLYOXALASE 2-2, Metallo-hydrol...		Lus10029086 [exp]	1.0	0.8905
AT1G75440		UBC16	ubiquitin-conjugating enzyme 1...		Lus10028341 [exp]	2.4	0.8808
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10028192 [exp]	2.4	0.8847
AT1G04290			Thioesterase superfamily prote...		Lus10004288 [exp]	10.8	0.8677
AT5G11680			unknown protein		Lus10027000 [exp]	10.8	0.8844
					Lus10034731 [exp]	11.8	0.8844
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Lus10014329 [exp]	13.4	0.8716
AT2G19790			SNARE-like superfamily protein...		Lus10035004 [exp]	15.7	0.8577
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Lus10009495 [exp]	16.6	0.8194
AT5G59140			BTB/POZ domain-containing prot...		Lus10016485 [exp]	17.7	0.8565

Compare expression of checked genes

Lus10007644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.