Lus10007648 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04900 87 / 4e-22 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT4G28556 82 / 1e-19 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT4G21745 78 / 2e-18 PAK-box/P21-Rho-binding family protein (.1)
AT2G20430 78 / 4e-18 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT2G33460 75 / 1e-16 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT1G04450 72 / 9e-16 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT3G23380 70 / 4e-15 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT1G03982 63 / 2e-12 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 59 / 1e-11 PAK-box/P21-Rho-binding family protein (.1)
AT5G16490 43 / 2e-05 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018362 256 / 4e-88 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 139 / 6e-42 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10011805 79 / 5e-18 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10003625 72 / 4e-16 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10020060 72 / 2e-15 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10008243 71 / 2e-15 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10021168 68 / 2e-13 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10021974 40 / 0.0002 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G025300 144 / 3e-44 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.004G020650 136 / 3e-41 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G035500 95 / 5e-24 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.005G227500 90 / 4e-22 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.010G069500 90 / 7e-22 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.008G168900 84 / 5e-20 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.002G233400 56 / 5e-10 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 46 / 1e-06 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.013G086600 42 / 7e-05 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 40 / 0.0002 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10007648 pacid=23140297 polypeptide=Lus10007648 locus=Lus10007648.g ID=Lus10007648.BGIv1.0 annot-version=v1.0
ATGGGTACCAACAAGATTAAAGTGTTCTACAAGGGTTTCAAGTTCATCACCCAAATCTTTGTTGTGAAGGAGAGGGAGTTGGAAATTGGGTACCCAACTG
ATGTTAAACATGTTGCTCATATTGGTTGGGATGGTGCCTCTGGTAATCCACCCAGCTGGATGAGTGAGTACAAGACAGCTCCTGAATTCTCCTCCTCAAA
GACTTTCAATAATGGTGGAGTCCCAAGAGAGTCCAATTCAACGTCCTTTTCTCCATGGTCCTCTCAAGATTTTAGTGAATCAATGGGACTCCATCAGCTG
CCAGGATCAAGCATGTTTGAACAGAACATTCCCAATTCAGACCCACCAAACATCCCAAAGAAACACAAGAGGAAGAAGAAGACTTCTTCGACATCAGCAT
CAACAATTTCTCCTCCTAAAGGCTCAACATCATCGTCGCCTCCAATGTCTTCATCTTCCTTGACCAAACCCTTTCGATCTTCAAAGAAGAAAGCAATGTA
CCACGAGCTAGACCACCCTACCGTGAACGTGCAAGCATAG
AA sequence
>Lus10007648 pacid=23140297 polypeptide=Lus10007648 locus=Lus10007648.g ID=Lus10007648.BGIv1.0 annot-version=v1.0
MGTNKIKVFYKGFKFITQIFVVKERELEIGYPTDVKHVAHIGWDGASGNPPSWMSEYKTAPEFSSSKTFNNGGVPRESNSTSFSPWSSQDFSESMGLHQL
PGSSMFEQNIPNSDPPNIPKKHKRKKKTSSTSASTISPPKGSTSSSPPMSSSSLTKPFRSSKKKAMYHELDHPTVNVQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10007648 0 1
AT4G13590 Uncharacterized protein family... Lus10023685 3.2 0.8578
AT3G13690 Protein kinase protein with ad... Lus10011656 3.5 0.8402
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10032281 9.5 0.7817
AT1G22630 unknown protein Lus10018614 12.6 0.8642
AT2G35450 catalytics;hydrolases (.1) Lus10037047 12.6 0.8429
AT5G38290 Peptidyl-tRNA hydrolase family... Lus10031327 17.6 0.8412
AT4G14660 NRPE7 RNA polymerase Rpb7-like, N-te... Lus10024250 18.3 0.8164
AT5G16140 Peptidyl-tRNA hydrolase family... Lus10031901 20.1 0.8461
AT5G13410 FKBP-like peptidyl-prolyl cis-... Lus10009828 25.4 0.8352
AT3G07568 unknown protein Lus10016081 25.8 0.7670

Lus10007648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.