Lus10007666 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21870 112 / 6e-33 HSP20-like chaperones superfamily protein (.1)
AT1G53540 77 / 1e-18 HSP20-like chaperones superfamily protein (.1)
AT1G07400 74 / 3e-17 HSP20-like chaperones superfamily protein (.1)
AT1G59860 71 / 4e-16 HSP20-like chaperones superfamily protein (.1)
AT5G12030 66 / 2e-14 AT-HSP17.6A heat shock protein 17.6A (.1)
AT5G37670 62 / 7e-13 HSP15.7CI HSP20-like chaperones superfamily protein (.1)
AT5G12020 61 / 2e-12 HSP17.6II 17.6 kDa class II heat shock protein (.1)
AT3G46230 59 / 1e-11 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT2G29500 58 / 2e-11 HSP20-like chaperones superfamily protein (.1)
AT5G59720 57 / 4e-11 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018346 238 / 1e-82 AT4G21870 118 / 5e-35 HSP20-like chaperones superfamily protein (.1)
Lus10042408 69 / 4e-15 AT4G10250 154 / 1e-47 HSP20-like chaperones superfamily protein (.1)
Lus10026262 69 / 6e-15 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1)
Lus10009085 62 / 6e-13 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10040723 60 / 5e-12 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10040722 58 / 3e-11 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016458 57 / 5e-11 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016456 57 / 8e-11 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016457 57 / 8e-11 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G001600 131 / 3e-40 AT4G21870 155 / 1e-49 HSP20-like chaperones superfamily protein (.1)
Potri.009G049900 75 / 7e-18 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1)
Potri.004G187450 75 / 8e-18 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.009G148000 74 / 3e-17 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 74 / 3e-17 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Potri.019G081250 73 / 4e-17 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.009G049800 72 / 1e-16 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
Potri.004G187400 71 / 2e-16 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
Potri.009G039200 70 / 8e-16 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
Potri.004G187202 69 / 2e-15 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10007666 pacid=23140282 polypeptide=Lus10007666 locus=Lus10007666.g ID=Lus10007666.BGIv1.0 annot-version=v1.0
ATGGATTTCTCTCCCAATCACTCGTCTCCATGGCAATATCTCATTGCTCCCGCCGGCGGAGTTCCCCGTTCCTTAGCTGTCCCTGCCAATTACGTCCACT
GGACTCAGAACCCCGACTCCCACATTTTCTCTGCCGACATCCCCGGGGTGAGGAAAGAGGATATAAGAGTGGAGGTGGAGAACTCCAGATATCTGATTAT
CCGGACCGACGGCTCAAATATCCCGCCGGAGAGGAGTTTCATGAGGAAATTCCGGCTGCCGGACTTGGTCTACGTGGACGGGATATCAGCTGCGTACGAA
GATGGTGTGTTGAAGGTCACCGTCCCTAGAGCTTCCAGAAGGATAGGAGTCTTCATTCACCCCGCTGACGTGCCGGCAAGATTGGACCGTCTGGCTCCGG
CTGCTTGA
AA sequence
>Lus10007666 pacid=23140282 polypeptide=Lus10007666 locus=Lus10007666.g ID=Lus10007666.BGIv1.0 annot-version=v1.0
MDFSPNHSSPWQYLIAPAGGVPRSLAVPANYVHWTQNPDSHIFSADIPGVRKEDIRVEVENSRYLIIRTDGSNIPPERSFMRKFRLPDLVYVDGISAAYE
DGVLKVTVPRASRRIGVFIHPADVPARLDRLAPAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21870 HSP20-like chaperones superfam... Lus10007666 0 1
AT2G14080 Disease resistance protein (TI... Lus10023330 2.0 0.8371
AT1G74250 DNAJ heat shock N-terminal dom... Lus10012524 2.0 0.8595
Lus10007688 3.0 0.7717
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10016498 4.4 0.7426
AT5G36930 Disease resistance protein (TI... Lus10023329 4.6 0.7852
AT3G13810 C2H2ZnF ATIDD11 indeterminate(ID)-domain 11 (.... Lus10004840 4.9 0.7734
AT1G74250 DNAJ heat shock N-terminal dom... Lus10022344 5.5 0.8214
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10035240 8.7 0.7303
Lus10029487 11.4 0.7005
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014219 15.5 0.7030

Lus10007666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.