Lus10007667 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007667 pacid=23165672 polypeptide=Lus10007667 locus=Lus10007667.g ID=Lus10007667.BGIv1.0 annot-version=v1.0
ATGTGTGCAGGCAACAGTTGCTCCTACTCATATGTGGAAGTGATCAAGGATGGCTCTGAAGGCAATGTGGCTGAGTCTCCATTGCGAGAGGAGCTTGCAC
CTTCATCTGCCCTTGTCTCACTGACTGGAGGGGGAGGGGTTGACATTGCTCAACCTTCTGAAGGAGAGGTAATAGATTCCCCTCAACAAGCGAGTCTAAT
CGAGGCCTCTACAGAGGTGGAGACAGAGAGCCCTAGAAGTGCTGAATATATGGAGACACTTGCAAAAACGATTGTGGATATCGCTGTTACAGTTGATGCT
GACACTAAACCCTCCAAATCTGAAGGCTACCACTTTGGCTGA
AA sequence
>Lus10007667 pacid=23165672 polypeptide=Lus10007667 locus=Lus10007667.g ID=Lus10007667.BGIv1.0 annot-version=v1.0
MCAGNSCSYSYVEVIKDGSEGNVAESPLREELAPSSALVSLTGGGGVDIAQPSEGEVIDSPQQASLIEASTEVETESPRSAEYMETLAKTIVDIAVTVDA
DTKPSKSEGYHFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007667 0 1
AT5G43430 ETFBETA electron transfer flavoprotein... Lus10022185 3.5 0.9035
AT5G04260 WCRKC2 WCRKC thioredoxin 2 (.1) Lus10038703 4.0 0.8859
AT2G02570 nucleic acid binding;RNA bindi... Lus10007436 4.9 0.8718
AT3G19460 Reticulon family protein (.1.2... Lus10019812 5.0 0.8810
AT3G53500 RSZ32, RS2Z32, ... arginine/serine-rich zinc knuc... Lus10009067 5.5 0.8895
AT1G10890 unknown protein Lus10043141 5.9 0.8767
AT1G04530 TPR4 tetratricopeptide repeat 4, Te... Lus10014468 6.0 0.8550
AT4G38070 bHLH basic helix-loop-helix (bHLH) ... Lus10002649 7.1 0.8681
AT1G12390 Cornichon family protein (.1) Lus10009295 8.7 0.8481
AT1G28490 OSM1, ATSYP61, ... syntaxin of plants 61 (.1.2) Lus10017686 10.0 0.8907

Lus10007667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.