Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22550 44 / 5e-06 Protein of unknown function (DUF581) (.1) AT5G11460 41 / 3e-05 Protein of unknown function (DUF581) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012417 [exp] 183 / 8e-58 AT3G22550 140 / 4e-38 Protein of unknown function (DUF581) (.1) Lus10025770 [exp] 42 / 2e-05 AT3G22550 100 / 2e-24 Protein of unknown function (DUF581) (.1) Lus10035894 [exp] 40 / 0.0001 AT3G22550 98 / 1e-23 Protein of unknown function (DUF581) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G245200 [exp] 91 / 9e-23 AT5G11460 144 / 2e-39 Protein of unknown function (DUF581) (.1) Potri.018G035400 [exp] 80 / 7e-19 AT5G11460 144 / 1e-39 Protein of unknown function (DUF581) (.1) Potri.001G179700 [exp] 49 / 6e-08 AT5G11460 141 / 1e-38 Protein of unknown function (DUF581) (.1) Potri.010G085700 [exp] 42 / 2e-05 AT3G22550 216 / 8e-69 Protein of unknown function (DUF581) (.1) Potri.008G154600 [exp] 41 / 5e-05 AT3G22550 219 / 2e-70 Protein of unknown function (DUF581) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007668 pacid=23165688 polypeptide=Lus10007668 locus=Lus10007668.g ID=Lus10007668.BGIv1.0 annot-version=v1.0 ATGTTGAGGAAAAAAAGCAGGTCAGTCCAGAAAGATCAACCTGAAATGGGTCTTCTGTTTAAAGTAGATGATTCTGCTAAAAGTCACATGAGAAGTTGTT TGTTCGTTGTACCTAGACTGTTTGTTGGATTTAGCTCTAATGGATTGTCAGATTCTGAGTACTCAGTCAACAGTCCAACATCACCTCTAGATCTTAAGGG GTTCTCAAATGTTGTAGGAAACCCTCCTCCTTATACCTTTCCAAGGTCATCCCACCAGAAGAGCTGGGATCGTAGTAGGCTCGGCTTAAGCATTGTAGAT TGTCTTGATGAGGGGCATTGA
AA sequence Show only first row Show all	>Lus10007668 pacid=23165688 polypeptide=Lus10007668 locus=Lus10007668.g ID=Lus10007668.BGIv1.0 annot-version=v1.0 MLRKKSRSVQKDQPEMGLLFKVDDSAKSHMRSCLFVVPRLFVGFSSNGLSDSEYSVNSPTSPLDLKGFSNVVGNPPPYTFPRSSHQKSWDRSRLGLSIVD CLDEGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22550			Protein of unknown function (D...		Lus10007668 [exp]	0	1
AT2G22140		ATEME1B	essential meiotic endonuclease...		Lus10006798 [exp]	2.4	0.7416
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Lus10013398 [exp]	7.9	0.7187
AT4G09820	bHLH	BHLH42, TT8, bH...	TRANSPARENT TESTA 8, basic hel...		Lus10022032 [exp]	8.5	0.7130
AT5G09995			unknown protein		Lus10035858 [exp]	20.5	0.7089
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043184 [exp]	21.2	0.7064
AT3G24080			KRR1 family protein (.1.2)		Lus10028084 [exp]	22.7	0.6852
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10012994 [exp]	22.8	0.7080
AT1G28600			GDSL-like Lipase/Acylhydrolase...		Lus10015477 [exp]	26.6	0.6793
AT4G28230			unknown protein		Lus10033724 [exp]	29.6	0.7123
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Lus10020700 [exp]	31.3	0.7080

Compare expression of checked genes

Lus10007668 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.