Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25570 74 / 2e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012419 [exp] 107 / 5e-32 AT5G25570 62 / 9e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G245100 [exp] 82 / 9e-22 AT5G25570 68 / 4e-16 unknown protein Potri.012G125000 [exp] 78 / 4e-20 AT5G25570 67 / 1e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007669 pacid=23165684 polypeptide=Lus10007669 locus=Lus10007669.g ID=Lus10007669.BGIv1.0 annot-version=v1.0 ATGGCTACTTCAAAGGAAGATACCCAGGCCCTGCAGCTTATCGTTACTTCTTCAGAAACTGAATCTCAGCTCTCCTCTCTCGTCTACGGTTCGTTCTCTT TCACTCAGACTTCTCTGTCATTACCGTGTAAACCTGAGCGAGATCTGTCGCAGCAAGTCCACTCGGCGATGGGTGACATGCTTAAGATGACAAGTGAAAT CGATCAGAATATTGCCGAAGTAATGGTGGAGATGGAGAAATGCAAAGATTTCGCTACGGAGAGGAAGAAAGCTCTGGATGAAGAGAAAGAGAAGTTTCAA AAGGCTGCTTACGCCGTTCTAGAGATGCTCGGCGGCTAA
AA sequence Show only first row Show all	>Lus10007669 pacid=23165684 polypeptide=Lus10007669 locus=Lus10007669.g ID=Lus10007669.BGIv1.0 annot-version=v1.0 MATSKEDTQALQLIVTSSETESQLSSLVYGSFSFTQTSLSLPCKPERDLSQQVHSAMGDMLKMTSEIDQNIAEVMVEMEKCKDFATERKKALDEEKEKFQ KAAYAVLEMLGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25570			unknown protein		Lus10007669 [exp]	0	1
					Lus10008817 [exp]	2.8	0.7108
AT3G47570			Leucine-rich repeat protein ki...		Lus10033363 [exp]	32.7	0.6368
					Lus10024839 [exp]	35.8	0.5964
AT3G56970	bHLH	ORG2, bHLH038	OBP3-RESPONSIVE GENE 3, basic ...		Lus10027300 [exp]	52.3	0.6197
AT5G13150		ATEXO70C1	exocyst subunit exo70 family p...		Lus10015757 [exp]	94.0	0.6013
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10017586 [exp]	201.1	0.5533
AT1G51650			ATP synthase epsilon chain, mi...		Lus10034841 [exp]	230.6	0.5404

Compare expression of checked genes

Lus10007669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.