Lus10007676 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25590 73 / 1e-16 Protein of unknown function (DUF630 and DUF632) (.1)
AT1G52320 65 / 8e-14 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022116 123 / 3e-34 AT5G25590 753 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1)
Lus10037901 100 / 1e-26 AT5G25590 627 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1)
Lus10025777 79 / 8e-19 AT1G52320 652 / 0.0 unknown protein
Lus10035887 78 / 3e-18 AT1G52320 747 / 0.0 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G036400 94 / 4e-24 AT5G25590 656 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1)
Potri.006G244100 81 / 3e-19 AT5G25590 603 / 0.0 Protein of unknown function (DUF630 and DUF632) (.1)
Potri.003G054800 69 / 4e-15 AT1G52320 626 / 0.0 unknown protein
Potri.001G181100 64 / 2e-13 AT1G52320 615 / 0.0 unknown protein
PFAM info
Representative CDS sequence
>Lus10007676 pacid=23165683 polypeptide=Lus10007676 locus=Lus10007676.g ID=Lus10007676.BGIv1.0 annot-version=v1.0
ATGCGGAGAGCCCCGTCTGAGGAGAGGGATGCTGCTGATAGAGTTGAAGATGCAAACCTAAAGGATCTTGTTGCAGAGAGGCAATTTGAAGTAGAGAGCC
TGCAGAAAAGACTAGAAGAGGAGGTTGAAGCTCATCAGAGGCATTGCCTACAAGTTAGGGAGAAGTCACTTGGAAGCCTTAAGACTCGTCTACCGGAGTT
GTTCGGGCTATGTCTGACTATTCACATGGCTGTTATGATACGTATGAGAAGATGA
AA sequence
>Lus10007676 pacid=23165683 polypeptide=Lus10007676 locus=Lus10007676.g ID=Lus10007676.BGIv1.0 annot-version=v1.0
MRRAPSEERDAADRVEDANLKDLVAERQFEVESLQKRLEEEVEAHQRHCLQVREKSLGSLKTRLPELFGLCLTIHMAVMIRMRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25590 Protein of unknown function (D... Lus10007676 0 1
AT2G31580 tRNAHis guanylyltransferase (.... Lus10006155 14.1 0.8578
AT1G67260 TCP TCP1 TCP family transcription facto... Lus10034072 15.3 0.8560
AT5G60970 TCP TCP5 TEOSINTE BRANCHED 1, cycloidea... Lus10017856 16.9 0.8552
AT3G14760 unknown protein Lus10042496 20.3 0.7839
AT5G59800 ATMBD7, MBD7 ARABIDOPSIS THALIANA METHYL-CP... Lus10040859 21.2 0.8429
AT1G15260 unknown protein Lus10011448 23.0 0.8521
AT5G16120 alpha/beta-Hydrolases superfam... Lus10017600 23.9 0.8446
AT3G02110 SCPL25 serine carboxypeptidase-like 2... Lus10015382 24.3 0.8409
AT5G11630 unknown protein Lus10002035 29.0 0.7288
Lus10014719 36.6 0.8427

Lus10007676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.