Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32690 72 / 5e-17 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022120 [exp] 0 / 1 AT4G32690 234 / 5e-80 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G244300 [exp] 88 / 3e-23 AT4G32690 262 / 6e-91 ARABIDOPSIS HEMOGLOBIN 3, hemoglobin 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007678 pacid=23165687 polypeptide=Lus10007678 locus=Lus10007678.g ID=Lus10007678.BGIv1.0 annot-version=v1.0 ATGCAGACGCTCCAAGAGAAAGTATCACAGTGGAGCGGAGTCGACCCGGCTGATGCCTTCGCCATTGACCAGACCAACTTGTTCCACAAATTAGGTCTCC AAACCTTCATCGACCTCTCCACTAACTTCTACAACAGGATGTCGAATAAGAGGAGCGGTTTAGATCGATATTTGCTAACTCCAAGAAAGAGGAAGCAATC CAGAACCAGTAAGAATTCTTTGTGCAGAGGATGGGCGGTCCTCCCTTGTATTCTCAGAGGAAAGGTTGGCACCCTCCTCCCCCCCCCCCCCCAGCCCACC CCATCCCTCAAACGCCCTAATGCTAATTGA
AA sequence Show only first row Show all	>Lus10007678 pacid=23165687 polypeptide=Lus10007678 locus=Lus10007678.g ID=Lus10007678.BGIv1.0 annot-version=v1.0 MQTLQEKVSQWSGVDPADAFAIDQTNLFHKLGLQTFIDLSTNFYNRMSNKRSGLDRYLLTPRKRKQSRTSKNSLCRGWAVLPCILRGKVGTLLPPPPQPT PSLKRPNAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G32690		ATGLB3, GLB3	ARABIDOPSIS HEMOGLOBIN 3, hemo...		Lus10007678 [exp]	0	1
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	5.2	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	7.3	1.0000
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	9.0	1.0000
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009630 [exp]	9.2	1.0000
					Lus10011605 [exp]	10.2	1.0000
AT3G06840			unknown protein		Lus10006494 [exp]	10.3	0.7085
					Lus10025268 [exp]	12.1	1.0000
					Lus10024141 [exp]	12.7	1.0000
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10026232 [exp]	13.0	1.0000
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10027988 [exp]	15.6	1.0000

Compare expression of checked genes

Lus10007678 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.