Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25735 53 / 1e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G036300 [exp] 65 / 2e-15 AT2G25735 51 / 1e-09 unknown protein Potri.006G244200 [exp] 64 / 7e-15 AT2G25735 49 / 1e-08 unknown protein Potri.003G055100 [exp] 49 / 5e-09 AT2G25735 / unknown protein Potri.001G180500 [exp] 47 / 4e-08 AT2G25735 40 / 3e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007679 pacid=23165680 polypeptide=Lus10007679 locus=Lus10007679.g ID=Lus10007679.BGIv1.0 annot-version=v1.0 ATGAGTAGAAGGAAGCGGATGATATTGGGAGCGGTTACTTGTAGTACTTCGGCGGCGGCGCGTGGCACTATGCAGGGTTACGACGCGGAGGAGTACATCA AGAATTTCGATCAAGGGATGGGGTGGGAGGAGCCTGATAACCTTCCCAGATCTTTCTCCGCCCGTTTTGCCGATCCTTCCAGAATCCTCCACCGCAGCGC CGGCACTTGTTACGCTAGATGA
AA sequence Show only first row Show all	>Lus10007679 pacid=23165680 polypeptide=Lus10007679 locus=Lus10007679.g ID=Lus10007679.BGIv1.0 annot-version=v1.0 MSRRKRMILGAVTCSTSAAARGTMQGYDAEEYIKNFDQGMGWEEPDNLPRSFSARFADPSRILHRSAGTCYAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25735			unknown protein		Lus10007679 [exp]	0	1
AT2G37430	C2H2ZnF	ZAT11	C2H2 and C2HC zinc fingers sup...		Lus10040312 [exp]	22.7	0.7963
AT5G18560	AP2_ERF	PUCHI	Integrase-type DNA-binding sup...		Lus10033963 [exp]	32.4	0.7741
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Lus10028215 [exp]	33.0	0.8455
					Lus10026059 [exp]	36.3	0.8187
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10013500 [exp]	52.9	0.8360
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012478 [exp]	53.4	0.8090
AT3G25160			ER lumen protein retaining rec...		Lus10022763 [exp]	57.9	0.8369
AT2G12550		NUB1	homolog of human NUB1, ubiquit...		Lus10008818 [exp]	59.2	0.8297
AT2G47730		GST6, ATGSTF5, ...	Arabidopsis thaliana glutathio...		Lus10026643 [exp]	60.4	0.8335
AT1G26680	B3	REM17	transcriptional factor B3 fami...		Lus10026234 [exp]	60.7	0.7978

Compare expression of checked genes

Lus10007679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.