Lus10007682 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15130 288 / 9e-94 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G37170 182 / 2e-53 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G13770 180 / 4e-53 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09410 181 / 5e-53 pentatricopeptide (PPR) repeat-containing protein (.1)
AT4G02750 181 / 8e-53 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G30700 179 / 2e-52 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G08820 177 / 1e-51 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G09950 178 / 2e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 177 / 3e-51 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40410 174 / 4e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030124 195 / 1e-59 AT3G15130 613 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022125 196 / 8e-58 AT5G11490 1337 / 0.0 adaptin family protein (.1.2)
Lus10005638 175 / 7e-55 AT5G40410 305 / 9e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 176 / 2e-52 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020588 170 / 2e-52 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10006073 178 / 3e-52 AT1G71420 471 / 1e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001617 177 / 6e-52 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040504 176 / 1e-51 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10029401 175 / 2e-51 AT1G34160 674 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G244500 339 / 2e-113 AT3G15130 891 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G018700 195 / 1e-57 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 191 / 4e-57 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G252400 186 / 2e-56 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G058900 191 / 5e-56 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G035900 187 / 1e-55 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G014800 184 / 1e-54 AT5G40410 749 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G354400 183 / 4e-54 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 182 / 5e-54 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 183 / 1e-53 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10007682 pacid=23165682 polypeptide=Lus10007682 locus=Lus10007682.g ID=Lus10007682.BGIv1.0 annot-version=v1.0
ATGCCCGTGGAACCAAATGCAGGCATATGGCAAACATTGCTTAGCGCGTGTCGAGTACATGGAGATATTTACATGGGAAGAGAAGTTGGTAACATCATTC
TCAGAATGGATGGAAATAACCCAATAAACTATGTGATGCTGTCAAATATGTACGCCAATGCTGGCTACTGGGAAGAATCCCAGACGCTAAGAGAAACAGT
GACATCAAAGAAACTGAAGAATGAAGCAGGGAGGAGCTGGGTTGAGATTGACAAGGAAATCCATTTATTCTATGGTGGAGATGACAGACATCCTCTAGCA
GAGCAAATACGGCAAGTACTGGAGGAGAAGGGGAGAAGAATGAAACAAGAGCTAGGGTATGGGAACGAAGTAAAGCATGCATCACACGACATTGATGAAG
AATCGATGAAAGAGAGCCTAAGATTTCATAGTGAGAAGTTGGCGATTGGGATGGCGTTGGTTTGCGGAGGGTGGGAGAAGACAAGGGTAATCCGGGTGTT
CAAGAACTTGAGAGTTTGTGCAGACTGTCATGAATTCATCAGAGGACTGTCAAGGATATTACAAGTGGTGTTCGTGGTAAGAGATGCTAACAGATTTCAC
AGGTTTGAAAATGGACTCTGTTCTTGCAGGGACTACTGGTGA
AA sequence
>Lus10007682 pacid=23165682 polypeptide=Lus10007682 locus=Lus10007682.g ID=Lus10007682.BGIv1.0 annot-version=v1.0
MPVEPNAGIWQTLLSACRVHGDIYMGREVGNIILRMDGNNPINYVMLSNMYANAGYWEESQTLRETVTSKKLKNEAGRSWVEIDKEIHLFYGGDDRHPLA
EQIRQVLEEKGRRMKQELGYGNEVKHASHDIDEESMKESLRFHSEKLAIGMALVCGGWEKTRVIRVFKNLRVCADCHEFIRGLSRILQVVFVVRDANRFH
RFENGLCSCRDYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15130 Tetratricopeptide repeat (TPR)... Lus10007682 0 1
AT3G07220 FHA SMAD/FHA domain-containing pro... Lus10038197 16.0 0.5482
AT3G55780 Glycosyl hydrolase superfamily... Lus10040232 17.7 0.5972
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10019652 19.1 0.6742
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10003681 19.7 0.7028
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10028249 23.5 0.7048
AT1G22100 Inositol-pentakisphosphate 2-k... Lus10024274 24.5 0.6549
AT5G64130 cAMP-regulated phosphoprotein ... Lus10028499 25.0 0.6327
AT5G04780 Pentatricopeptide repeat (PPR)... Lus10021649 28.8 0.6783
AT1G29270 unknown protein Lus10007304 32.4 0.6935
AT3G57080 RPB5B, NRPE5 RNA POLYMERASE II FIFTH LARGES... Lus10018022 35.9 0.6595

Lus10007682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.