Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20540 170 / 2e-51 MEF21 mitochondrial editing factor 21 (.1) AT4G33990 118 / 6e-32 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G14330 116 / 2e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18750 115 / 7e-31 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G04750 114 / 2e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 114 / 2e-30 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G05750 113 / 2e-30 PDE247, CLB19 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G40405 112 / 4e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G26782 112 / 1e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G14820 110 / 2e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022124 [exp] 227 / 2e-76 AT2G20540 345 / 1e-116 mitochondrial editing factor 21 (.1) Lus10030125 [exp] 231 / 2e-75 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1) Lus10016387 [exp] 117 / 7e-32 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029853 [exp] 114 / 1e-30 AT1G09190 575 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019735 [exp] 114 / 1e-30 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015225 [exp] 112 / 6e-30 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008967 [exp] 112 / 6e-30 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035788 [exp] 112 / 7e-30 AT3G16610 636 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10037362 [exp] 112 / 1e-29 AT3G57430 477 / 9e-158 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G035900 [exp] 182 / 3e-56 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1) Potri.003G223900 [exp] 120 / 7e-33 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G059400 [exp] 120 / 7e-33 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G065500 [exp] 117 / 1e-31 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G012600 [exp] 115 / 4e-31 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.015G047600 [exp] 115 / 6e-31 AT1G18485 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G466066 [exp] 114 / 1e-30 AT4G33990 1067 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G121400 [exp] 114 / 1e-30 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G071800 [exp] 114 / 2e-30 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G085500 [exp] 112 / 6e-30 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007684 pacid=23165692 polypeptide=Lus10007684 locus=Lus10007684.g ID=Lus10007684.BGIv1.0 annot-version=v1.0 ATGTTCGAGAGAATGAAGCTCCAAGGGATTGAGCCGAACGGAATTACGTTTCTGGGTCTTCTATCTGCTTGTGCGCACGCTGGTTTATGGCAGCAAGGTG TGAGGTCCTTCGACTATATGCGAGATGACTGCCTCATAGAGCCTGTAATTGAGCACTTTGGAGTTCTAGTTGATCTTAACGTTATAGAACATATGCCAAT GAGACCTGATTCTAAGATTTGGGGTTCGCTGTTGAGTTCTTGCAGGACTCATGGGAATCTGGATATCGCTGTGGTTGCAATGAAGCACCTTGAAGAGCTG GAACTAGAAGACACGGGGAATTATGTTTTGCTTTCAAATACATATGCTGACCTGGGTAAGTGA
AA sequence Show only first row Show all	>Lus10007684 pacid=23165692 polypeptide=Lus10007684 locus=Lus10007684.g ID=Lus10007684.BGIv1.0 annot-version=v1.0 MFERMKLQGIEPNGITFLGLLSACAHAGLWQQGVRSFDYMRDDCLIEPVIEHFGVLVDLNVIEHMPMRPDSKIWGSLLSSCRTHGNLDIAVVAMKHLEEL ELEDTGNYVLLSNTYADLGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20540		MEF21	mitochondrial editing factor ...		Lus10007684 [exp]	0	1
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Lus10009746 [exp]	1.0	0.6329
AT4G14000			Putative methyltransferase fam...		Lus10023222 [exp]	18.5	0.5402
					Lus10024679 [exp]	19.9	0.5327
					Lus10005512 [exp]	20.3	0.5329
AT4G12490			Bifunctional inhibitor/lipid-t...		Lus10024619 [exp]	30.2	0.4985
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10032323 [exp]	42.7	0.4923
AT5G20810			SAUR-like auxin-responsive pro...		Lus10034888 [exp]	53.4	0.4596
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10001292 [exp]	63.9	0.4921
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Lus10033389 [exp]	75.9	0.4374
AT5G55125			Ribosomal protein L31 (.1.2)		Lus10000695 [exp]	94.2	0.4230

Compare expression of checked genes

Lus10007684 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.