Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20540 62 / 7e-13 MEF21 mitochondrial editing factor 21 (.1) AT1G08070 56 / 6e-11 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G59720 54 / 3e-10 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G29760 54 / 3e-10 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49142 48 / 4e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22410 47 / 1e-07 SLO1 SLOW GROWTH 1 (.1) AT1G11290 46 / 1e-07 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G28660 46 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02750 46 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G02980 45 / 4e-07 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022124 [exp] 131 / 1e-39 AT2G20540 345 / 1e-116 mitochondrial editing factor 21 (.1) Lus10030125 [exp] 133 / 8e-39 AT2G20540 618 / 0.0 mitochondrial editing factor 21 (.1) Lus10033026 [exp] 50 / 8e-09 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014211 [exp] 49 / 3e-08 AT3G11460 791 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002288 [exp] 48 / 4e-08 AT1G31430 689 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10000110 [exp] 48 / 4e-08 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017446 [exp] 48 / 5e-08 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018223 [exp] 48 / 5e-08 AT2G29760 931 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040680 [exp] 48 / 5e-08 AT2G29760 926 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G035900 [exp] 81 / 7e-20 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1) Potri.008G106500 [exp] 57 / 2e-11 AT2G29760 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G050200 [exp] 57 / 2e-11 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G031600 [exp] 57 / 3e-11 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G027800 [exp] 51 / 4e-09 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G191000 [exp] 51 / 4e-09 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G090600 [exp] 50 / 6e-09 AT2G40720 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G239600 [exp] 50 / 7e-09 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G103600 [exp] 50 / 8e-09 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G044700 [exp] 50 / 1e-08 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007685 pacid=23165685 polypeptide=Lus10007685 locus=Lus10007685.g ID=Lus10007685.BGIv1.0 annot-version=v1.0 ATGAGGACACTAATAAGAAGCAAGGGCATGAAGAAAACTCCAGGGTGTAGCTCGATTGAAATCAACAATGTAGCTACTGAGTTCTCTTCTGGCGATGATT CGAAGCCCTTCTCAAGACAGATCTTCAAGTTGCTAGAGATGCTGACTTCTTGTGAGGAGATAAGTGATCAAATACTTGACATCATTCCAGAGGATGCAGG CAGCTGA
AA sequence Show only first row Show all	>Lus10007685 pacid=23165685 polypeptide=Lus10007685 locus=Lus10007685.g ID=Lus10007685.BGIv1.0 annot-version=v1.0 MRTLIRSKGMKKTPGCSSIEINNVATEFSSGDDSKPFSRQIFKLLEMLTSCEEISDQILDIIPEDAGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20540		MEF21	mitochondrial editing factor ...		Lus10007685 [exp]	0	1
AT2G27410	B3		Domain of unknown function (DU...		Lus10038980 [exp]	18.1	0.6212
					Lus10038177 [exp]	23.3	0.5938
AT1G05020			ENTH/ANTH/VHS superfamily prot...		Lus10035340 [exp]	26.6	0.6091
AT5G19750			Peroxisomal membrane 22 kDa (M...		Lus10010446 [exp]	31.4	0.5612
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10019836 [exp]	31.9	0.5781
AT5G41720			unknown protein		Lus10006473 [exp]	38.1	0.6046
					Lus10003927 [exp]	39.9	0.5619
AT4G36860		DAR1	DA1-RELATED PROTEIN 1, LIM dom...		Lus10000138 [exp]	44.9	0.5768
AT5G59790			Domain of unknown function (DU...		Lus10030328 [exp]	52.3	0.5213
AT4G10265			Wound-responsive family protei...		Lus10039760 [exp]	84.9	0.5336

Compare expression of checked genes

Lus10007685 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.