Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46060 336 / 5e-119 ARA3, Ara-3, AtRABE1c, AtRab8A RAB GTPase homolog 8A (.1.2.3) AT5G59840 335 / 1e-118 Ras-related small GTP-binding family protein (.1) AT3G53610 333 / 7e-118 ATRAB8, AtRab8B, AtRABE1a RAB GTPase homolog 8 (.1.2.3) AT5G03520 309 / 3e-108 ATRAB-E1D, AtRab8C, AtRABE1d ARABIDOPSIS RAB HOMOLOG E1D, RAB GTPase homolog 8C (.1.2) AT3G09900 298 / 4e-104 AtRABE1e, AtRab8E RAB GTPase homolog E1E (.1) AT1G02130 206 / 1e-67 ARA5, AtRABD2a, AtRab1B, Ara-5 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) AT4G17530 194 / 3e-63 RAB1C, AtRab1C, AtRABD2c RAB GTPase homolog 1C (.1) AT5G47200 193 / 1e-62 AtRABD2b, AtRab1A ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1) AT3G11730 188 / 1e-60 ATFP8, AtRABD1 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1) AT4G17160 163 / 6e-51 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024423 [exp] 351 / 3e-125 AT3G46060 376 / 7e-135 RAB GTPase homolog 8A (.1.2.3) Lus10025309 [exp] 349 / 4e-124 AT3G46060 374 / 1e-133 RAB GTPase homolog 8A (.1.2.3) Lus10005890 [exp] 330 / 2e-116 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3) Lus10023430 [exp] 328 / 2e-115 AT3G46060 364 / 3e-129 RAB GTPase homolog 8A (.1.2.3) Lus10040856 [exp] 325 / 7e-115 AT3G46060 366 / 7e-131 RAB GTPase homolog 8A (.1.2.3) Lus10005443 [exp] 326 / 8e-115 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10004944 [exp] 318 / 4e-112 AT3G46060 348 / 1e-123 RAB GTPase homolog 8A (.1.2.3) Lus10003984 [exp] 256 / 5e-88 AT3G46060 289 / 5e-101 RAB GTPase homolog 8A (.1.2.3) Lus10000595 [exp] 196 / 7e-64 AT5G47200 387 / 3e-139 ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208900 [exp] 338 / 7e-120 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3) Potri.008G051700 [exp] 337 / 2e-119 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3) Potri.009G027900 [exp] 322 / 2e-113 AT3G46060 341 / 8e-121 RAB GTPase homolog 8A (.1.2.3) Potri.001G236100 [exp] 316 / 4e-111 AT5G59840 333 / 1e-117 Ras-related small GTP-binding family protein (.1) Potri.001G080400 [exp] 196 / 5e-64 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.003G081800 [exp] 196 / 1e-63 AT1G02130 391 / 9e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.002G138400 [exp] 194 / 3e-63 AT1G02130 393 / 1e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.014G049400 [exp] 194 / 4e-63 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G152800 [exp] 194 / 5e-63 AT1G02130 382 / 2e-137 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.004G226600 [exp] 186 / 6e-60 AT3G11730 364 / 4e-130 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10007698 pacid=23153279 polypeptide=Lus10007698 locus=Lus10007698.g ID=Lus10007698.BGIv1.0 annot-version=v1.0 ATGGATTTGAAGCTTGCATCAAGTGGTGTGGGTAAGAGTTGCCTCCTCCTACGTTTCTCAGATGGTTCCTTCACCACTAGTTTCATTACGACCATAGGTA TTGATTTCAAGATAAGGACAATTGAGCTTGATGGAAAACGGATCAAGTTGCAGATATGGGATACTGCTGGTCAAGAGCGTTTCCGTACTATTACAACTGC TTACTATCGTGGGGCAATGGGTATTTTGCTCGTTTATGATGTCACTGATGAGTCATCATTCAACAATATTAGGAATTGGATTCGCAACATTGAACAACAT GCCTCTGACAATGTGAACAAGATCCTGGTTGGAAACAAAGCCGATATGGATGAGAGCAAAAGGGCGGTTCCTACCGCAAAGGGCCAGGCTCTTGCAGACG AATATGGCATCAAGTTCTTTGAGACTAGTGCAAAGACAAACTTAAACGTGGAGGAGGTTTTCTTCTCAATAGCTAGAGACATCAAGCAACGACTTGCAGA TACCGATTCAAAATCCGAGCCACAGACGATCAAGATTAACCAGCCGGACCAGGCGGGTGGTTCGAACCAGGCTGCACAAAAGTCTGCTTGCTGTGGTTCG TAA
AA sequence Show only first row Show all	>Lus10007698 pacid=23153279 polypeptide=Lus10007698 locus=Lus10007698.g ID=Lus10007698.BGIv1.0 annot-version=v1.0 MDLKLASSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQH ASDNVNKILVGNKADMDESKRAVPTAKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQRLADTDSKSEPQTIKINQPDQAGGSNQAAQKSACCGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10007698 [exp]	0	1
AT1G69340			appr-1-p processing enzyme fam...		Lus10037119 [exp]	4.5	0.8618
AT5G62960			unknown protein		Lus10032130 [exp]	11.7	0.8229
AT5G49950			alpha/beta-Hydrolases superfam...		Lus10037325 [exp]	17.9	0.8190
AT3G51830		ATG5, SAC8	SAC domain-containing protein ...		Lus10025267 [exp]	24.6	0.8392
					Lus10042098 [exp]	27.5	0.8131
AT5G40440		ATMKK3	mitogen-activated protein kina...		Lus10022265 [exp]	31.4	0.7958
AT2G16460			Protein of unknown function (D...		Lus10018079 [exp]	35.2	0.8144
AT3G27970			Exonuclease family protein (.1...		Lus10008787 [exp]	36.6	0.7736
AT2G48030			DNAse I-like superfamily prote...		Lus10029630 [exp]	41.7	0.7728
AT4G09510		A/N-InvI, CINV2	alkaline/neutral invertase I, ...		Lus10006078 [exp]	48.1	0.7651

Compare expression of checked genes

Lus10007698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.