Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30780 74 / 1e-16 unknown protein AT2G24100 62 / 2e-12 ASG1 ALTERED SEED GERMINATION 1, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036602 [exp] 107 / 2e-28 AT4G30780 511 / 5e-176 unknown protein Lus10035819 [exp] 101 / 2e-26 AT4G30780 514 / 3e-177 unknown protein Lus10041622 [exp] 65 / 2e-13 AT2G24100 351 / 1e-116 ALTERED SEED GERMINATION 1, unknown protein Lus10024097 [exp] 60 / 1e-11 AT2G24100 335 / 2e-110 ALTERED SEED GERMINATION 1, unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G102800 [exp] 91 / 2e-22 AT4G30780 501 / 1e-172 unknown protein Potri.006G180500 [exp] 85 / 2e-20 AT4G30780 503 / 2e-173 unknown protein Potri.003G185050 [exp] 72 / 9e-16 AT2G24100 392 / 2e-132 ALTERED SEED GERMINATION 1, unknown protein Potri.001G041800 [exp] 64 / 3e-13 AT2G24100 363 / 5e-121 ALTERED SEED GERMINATION 1, unknown protein Potri.013G009000 [exp] 38 / 0.0004 AT2G24100 202 / 6e-59 ALTERED SEED GERMINATION 1, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007704 pacid=23153286 polypeptide=Lus10007704 locus=Lus10007704.g ID=Lus10007704.BGIv1.0 annot-version=v1.0 ATGCAACCGAAACCGCAATTCAAGATTCATGGACCGGTATCTATGGATAAGCATCTGACATCATCAAGGTGCAGGCAACATTTTCTGCAATGCACCCAGG GGATGTTGAATAAACAATTTGAGAAGATCATACAGTGTGATATGTTGTTAAGTAAGCAAGCAGAGATAGTTCTGGATTCACCCTACTTTGAACAGAAGGC ATCTGTTTTTAATGACCTGGATGAATCCAACGACCAGGAGTTCATTCCAGTGGAGTATGGAAAAGGATCATTTGCAGCTCATTCATCTTCATTCGAGGAT GTCTCTAGCAGCTTCATCTCTTGA
AA sequence Show only first row Show all	>Lus10007704 pacid=23153286 polypeptide=Lus10007704 locus=Lus10007704.g ID=Lus10007704.BGIv1.0 annot-version=v1.0 MQPKPQFKIHGPVSMDKHLTSSRCRQHFLQCTQGMLNKQFEKIIQCDMLLSKQAEIVLDSPYFEQKASVFNDLDESNDQEFIPVEYGKGSFAAHSSSFED VSSSFIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30780			unknown protein		Lus10007704 [exp]	0	1
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Lus10030041 [exp]	14.8	0.6177
AT4G00440			Protein of unknown function (D...		Lus10036356 [exp]	19.6	0.6822
AT1G54340		ICDH	isocitrate dehydrogenase (.1)		Lus10010431 [exp]	20.1	0.7081
AT5G65020		ANNAT2	annexin 2 (.1.2)		Lus10041696 [exp]	25.3	0.6355
AT4G33920			Protein phosphatase 2C family ...		Lus10011521 [exp]	26.2	0.7080
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10042419 [exp]	27.3	0.7075
AT2G39435			Phosphatidylinositol N-acetygl...		Lus10003295 [exp]	36.9	0.6932
AT3G10360		APUM4	pumilio 4 (.1)		Lus10038706 [exp]	37.5	0.6429
AT4G23700		ATCHX17	cation/H+ exchanger 17, cation...		Lus10024717 [exp]	44.9	0.6654
AT1G67710	GARP	ARR11	response regulator 11 (.1)		Lus10011389 [exp]	48.9	0.6646

Compare expression of checked genes

Lus10007704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.