Lus10007706 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24090 150 / 2e-47 Ribosomal protein L35 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G102700 176 / 2e-57 AT2G24090 162 / 4e-52 Ribosomal protein L35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01632 Ribosomal_L35p Ribosomal protein L35
Representative CDS sequence
>Lus10007706 pacid=23153289 polypeptide=Lus10007706 locus=Lus10007706.g ID=Lus10007706.BGIv1.0 annot-version=v1.0
ATGGCTTCTTTAACCTTGCTCTCTGTCAATCCCACGCTTTGTTCACTACCAGCCCGAGTCTCTCTCGGGTCGACCCGACTCGCCTCTTTCACCAAGTCCA
ACAACAGCTCGCCGAAGCTCAGCTTCACGCCCATCATCTCCTCGGCTCCTCTCTCGCTTTTCTCGCCCAAACCTTACTCTATCGCCTCTTTGTCTAAGAG
ACTCAAATCTCTCACCGTCTACGCCGCCAAAGGATACAAGTTGAAGACCCATAAGGCCTCAGCGAAGAGGTTTCGGGTGACTGGGAGAGGGAAGATTGTT
AGGAGGAGGGCTGGAAAGCAGCATTTGCTGGCTAAGAAGAACACCAAGAGGAGATTGCGTTTATCCAAAATGACTCAAGTCGACCGGAGTGACTACAACA
ACGTGATTGGTGCACTGCCGTACTTGAAAGTGAACAGATTGGCAAAGTAG
AA sequence
>Lus10007706 pacid=23153289 polypeptide=Lus10007706 locus=Lus10007706.g ID=Lus10007706.BGIv1.0 annot-version=v1.0
MASLTLLSVNPTLCSLPARVSLGSTRLASFTKSNNSSPKLSFTPIISSAPLSLFSPKPYSIASLSKRLKSLTVYAAKGYKLKTHKASAKRFRVTGRGKIV
RRRAGKQHLLAKKNTKRRLRLSKMTQVDRSDYNNVIGALPYLKVNRLAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G24090 Ribosomal protein L35 (.1) Lus10007706 0 1
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10018192 1.7 0.9629
AT1G64510 Translation elongation factor... Lus10032419 2.0 0.9659
AT4G01310 Ribosomal L5P family protein (... Lus10007915 2.2 0.9602
AT5G54190 PORA protochlorophyllide oxidoreduc... Lus10039810 3.7 0.9630
AT3G54210 Ribosomal protein L17 family p... Lus10006999 4.5 0.9629
AT4G09040 RNA-binding (RRM/RBD/RNP motif... Lus10020945 5.3 0.9341
AT5G45930 CHLI-2, CHLI2 magnesium chelatase i2 (.1) Lus10025423 6.0 0.9563
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Lus10025445 8.4 0.9493
AT4G25080 CHLM magnesium-protoporphyrin IX me... Lus10036021 8.5 0.9536
AT3G54210 Ribosomal protein L17 family p... Lus10007002 12.2 0.9461

Lus10007706 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.