Lus10007709 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035823 54 / 5e-09 AT4G30920 776 / 0.0 leucyl aminopeptidase 2, Cytosol aminopeptidase family protein (.1)
Lus10036605 39 / 0.0006 AT4G30850 259 / 3e-84 heptahelical transmembrane protein2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G102400 40 / 0.0003 AT4G30850 374 / 5e-129 heptahelical transmembrane protein2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10007709 pacid=23153285 polypeptide=Lus10007709 locus=Lus10007709.g ID=Lus10007709.BGIv1.0 annot-version=v1.0
ATGTCGGCGACAGTGGCGGTGGCGGAGGAGGAGGATGATGCCGGAGTAATGACCTCCTCTTGCTGTGGCAGCGATCGGAAGAAGAAGGTCAAATCGAAAA
CGAGGCTGGTGAAATACAACGACCTGCCGGATTATTTGAAGGACAACGAGCGAGTTTATCTTGGACCATTACCGGTCGGAATGGCCGCTGCGGGATGCGC
TGTGGAGCGTTTTCTCCTGGCACAACGAAACCATCAACATATAGACGTAAAGGCCCGATTGAAAGAAATGTCAGCTCGGATTTTGAATTTCTTCGATTGG
CATTTAGTCGGATTCTTAATCTTCGCCGGACTCGCCGTGGTGAGTTTCTTGGGTAAAATAGACGAGCTCGGAGGATTTCTCACGAGCTTCTCGAGGTACG
ATCGGTGGATATTCAACTTTTCTTCCATCGGAGATGGATTTTCCGATTGA
AA sequence
>Lus10007709 pacid=23153285 polypeptide=Lus10007709 locus=Lus10007709.g ID=Lus10007709.BGIv1.0 annot-version=v1.0
MSATVAVAEEEDDAGVMTSSCCGSDRKKKVKSKTRLVKYNDLPDYLKDNERVYLGPLPVGMAAAGCAVERFLLAQRNHQHIDVKARLKEMSARILNFFDW
HLVGFLIFAGLAVVSFLGKIDELGGFLTSFSRYDRWIFNFSSIGDGFSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007709 0 1
AT1G04010 ATPSAT1 phospholipid sterol acyl trans... Lus10003615 15.3 0.6849
AT4G23440 Disease resistance protein (TI... Lus10024640 21.4 0.6755
AT2G45220 Plant invertase/pectin methyle... Lus10027206 30.8 0.6176
AT4G37280 MRG family protein (.1) Lus10019311 33.7 0.5937
AT5G23750 Remorin family protein (.1.2) Lus10008014 55.3 0.5687
AT5G22410 RHS18 root hair specific 18 (.1) Lus10004859 57.4 0.5617
AT4G02270 RHS13 root hair specific 13 (.1) Lus10005539 61.2 0.5642
AT1G30870 Peroxidase superfamily protein... Lus10038393 61.8 0.5470
AT3G11980 FAR2, MS2 MALE STERILITY 2, FATTY ACID R... Lus10015974 90.1 0.5426
AT3G10710 RHS12 root hair specific 12 (.1) Lus10034859 96.7 0.5192

Lus10007709 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.