Gene [FLAX] | FIBexDB

Lus10007713 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT5G48670	71 / 2e-15	MADS	FEM111, AGL80	AGAMOUS-like 80 (.1)
AT1G65330	57 / 2e-10	MADS	AGL37, PHE1	PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1)
AT5G27810	52 / 1e-09	MADS		MADS-box transcription factor family protein (.1)
AT5G26630	53 / 2e-09	MADS		MADS-box transcription factor family protein (.1)
AT3G05860	52 / 6e-09	MADS		MADS-box transcription factor family protein (.1.2.3)
AT1G65300	52 / 7e-09	MADS	AGL38, PHE2	PHERES2, AGAMOUS-like 38 (.1)
AT5G26650	52 / 9e-09	MADS	AGL36	AGAMOUS-like 36 (.1)
AT1G31640	52 / 1e-08	MADS	AGL92	AGAMOUS-like 92 (.1)
AT5G27960	50 / 2e-08	MADS	AGL90	AGAMOUS-like 90 (.1)
AT1G31630	49 / 7e-08	MADS	AGL86	AGAMOUS-like 86 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10007711 [exp]	137 / 5e-43	AT5G48670	83 / 5e-20	AGAMOUS-like 80 (.1)
Lus10022316 [exp]	103 / 4e-28	AT5G48670	131 / 2e-36	AGAMOUS-like 80 (.1)
Lus10014883 [exp]	102 / 8e-28	AT5G48670	114 / 1e-29	AGAMOUS-like 80 (.1)
Lus10022325 [exp]	96 / 2e-25	AT1G65300	113 / 1e-30	PHERES2, AGAMOUS-like 38 (.1)
Lus10014578 [exp]	93 / 5e-24	AT5G48670	182 / 5e-56	AGAMOUS-like 80 (.1)
Lus10032108 [exp]	89 / 3e-22	AT5G48670	180 / 9e-55	AGAMOUS-like 80 (.1)
Lus10001689 [exp]	66 / 2e-15	AT5G27810	51 / 5e-10	MADS-box transcription factor family protein (.1)
Lus10004459 [exp]	63 / 4e-14	AT5G27810	46 / 6e-08	MADS-box transcription factor family protein (.1)
Lus10000400 [exp]	60 / 6e-13	ND	42 / 3e-06

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.013G018100 [exp]	80 / 2e-19	AT5G48670	187 / 1e-58	AGAMOUS-like 80 (.1)
Potri.005G002400 [exp]	81 / 3e-19	AT5G48670	222 / 4e-71	AGAMOUS-like 80 (.1)
Potri.013G001700 [exp]	79 / 4e-19	AT5G48670	203 / 3e-64	AGAMOUS-like 80 (.1)
Potri.016G068132 [exp]	59 / 2e-11	AT5G48670	125 / 1e-34	AGAMOUS-like 80 (.1)
Potri.006G201700 [exp]	59 / 2e-11	AT5G48670	120 / 2e-30	AGAMOUS-like 80 (.1)
Potri.013G107600 [exp]	56 / 1e-10	AT1G22590	117 / 9e-34	AGAMOUS-like 87 (.1.2)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF00319 [flax] [poplar]	SRF-TF	SRF-type transcription factor (DNA-binding and dimerisation domain)

Representative CDS sequence

Show only first row Show all

>Lus10007713 pacid=23153287 polypeptide=Lus10007713 locus=Lus10007713.g ID=Lus10007713.BGIv1.0 annot-version=v1.0

ATGACTAGAAAGAAAGTGAAGCTAGTGTGCATAACAAACGAATCAGCCATGAAGGTGTCATTGAAGAAGCGGAAGAGGGGACTGATGAAAAAATTGAGGG

AGCTATGCACTCTCTGCGATATCCAAGCATGTGCCATCGCCAACAACCCACATGATGACATGCAAACATCTGAGACTTGGCCGCCAATTTTGGGCAGGGT

CCACGAGGTGTTGACCTGCTTTAAGAATATGCCCAACATGGACCTGGCCAAGAATATGGTCAACCGGGAGGAGATCCTTTCCAACTGGATCAAGAAGACC

CACAATCACAGGTCGAATGGAGCTCCAAGATTTGACCATGAACGATATTGA

AA sequence

Show only first row Show all

>Lus10007713 pacid=23153287 polypeptide=Lus10007713 locus=Lus10007713.g ID=Lus10007713.BGIv1.0 annot-version=v1.0

MTRKKVKLVCITNESAMKVSLKKRKRGLMKKLRELCTLCDIQACAIANNPHDDMQTSETWPPILGRVHEVLTCFKNMPNMDLAKNMVNREEILSNWIKKT

HNHRSNGAPRFDHERY

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65330	MADS	AGL37, PHE1	PHERES1, AGAMOUS-like 37, MADS...		Lus10007713 [exp]	0	1

Lus10007713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.