Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018677 [exp] 57 / 8e-12 AT5G63905 52 / 4e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G015866 [exp] 50 / 3e-09 AT5G63905 44 / 1e-07 unknown protein Potri.002G118366 [exp] 47 / 5e-08 AT5G63905 40 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007744 pacid=23149235 polypeptide=Lus10007744 locus=Lus10007744.g ID=Lus10007744.BGIv1.0 annot-version=v1.0 ATGGGGATGTCGTGCTTTGCTTGTTTCGGCGGAGGAGACAAGCGACAGATGGCGGAGGAAGCGCAGTGTGCCTCCGCTGAGGCTCGCGCTAAAGCCGCCG ATGCCGCTCAGAAAAGGCAAGAAGAATTCGAAAAATCTGCTGCTGGAAGGGCTGCACGTGCACAGATACAGGGAATGGCTAAGCAATCTGCAAACCAAAA TAGAGGCGAACCAGTCCTCAAGGACGATGCATTGGCACAGAGGTCTAGAGGTCAGAGGAGGAGGAGAGGTGGGAATATATGCTGGGGCATTGGACTCTAC TCCTTTTGA
AA sequence Show only first row Show all	>Lus10007744 pacid=23149235 polypeptide=Lus10007744 locus=Lus10007744.g ID=Lus10007744.BGIv1.0 annot-version=v1.0 MGMSCFACFGGGDKRQMAEEAQCASAEARAKAADAAQKRQEEFEKSAAGRAARAQIQGMAKQSANQNRGEPVLKDDALAQRSRGQRRRRGGNICWGIGLY SF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63905			unknown protein		Lus10007744 [exp]	0	1
AT4G27120			unknown protein		Lus10043066 [exp]	2.0	0.8113
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Lus10000603 [exp]	4.5	0.8026
AT5G66200		ARO2	armadillo repeat only 2 (.1)		Lus10036897 [exp]	6.7	0.7937
AT4G04614			unknown protein		Lus10006902 [exp]	11.4	0.7932
AT5G60335			Thioesterase superfamily prote...		Lus10009162 [exp]	12.1	0.7942
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10043263 [exp]	12.2	0.8016
AT3G52280		GTE6	general transcription factor g...		Lus10008393 [exp]	13.0	0.7564
AT1G04985			unknown protein		Lus10031525 [exp]	14.9	0.6642
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10019188 [exp]	15.4	0.7982
AT1G76570			Chlorophyll A-B binding family...		Lus10015235 [exp]	15.7	0.7953

Compare expression of checked genes

Lus10007744 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.