Lus10007750 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018673 137 / 2e-39 AT3G12350 365 / 1e-123 F-box family protein (.1.2)
Lus10010606 55 / 3e-10 AT3G12350 106 / 6e-29 F-box family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G117900 58 / 2e-10 AT3G12350 374 / 7e-127 F-box family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10007750 pacid=23149246 polypeptide=Lus10007750 locus=Lus10007750.g ID=Lus10007750.BGIv1.0 annot-version=v1.0
ATGAAAAGAAATGGCGACTTGAGGTACCGTTTTGAGTGGGAGAGACTCAGGAACCACGAAGGAAAGAGGCCCCTGTTAGAATTAGGGAATTGCAAAAACT
CTCAATCCTCTCCTATACAAAAAGCTCCCACCCCCCCACGCGAAGAAGACAAGAGACGGCGGTTTTGCCACTCCGGCGGCGGAGGAGTTGATTTTCTGCT
GGGTTTGGCCGCAGCGACGCTAGAAGCCGATGAAACTCTCCCATTTGTTCAGGGTCTTGTAGAGGAAGTTGAAGGAGATGTTGCCACTCCCCCAATTTCT
GATCTGGGTCTTGGAGCCCCACCGCCTGTCGCAGAGAGCGTACCAGAGCTTGCTGTCGGTGTGGCAAAGTGGGGCGAATCGCTTGGAAGTGCAGGAGAAA
TTGGCGATGATATCGGTCGGGGAAAGAAATGA
AA sequence
>Lus10007750 pacid=23149246 polypeptide=Lus10007750 locus=Lus10007750.g ID=Lus10007750.BGIv1.0 annot-version=v1.0
MKRNGDLRYRFEWERLRNHEGKRPLLELGNCKNSQSSPIQKAPTPPREEDKRRRFCHSGGGGVDFLLGLAAATLEADETLPFVQGLVEEVEGDVATPPIS
DLGLGAPPPVAESVPELAVGVAKWGESLGSAGEIGDDIGRGKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007750 0 1
AT3G28630 Protein of unknown function (D... Lus10015346 2.0 0.9061
AT3G54070 Ankyrin repeat family protein ... Lus10038357 8.9 0.9002
Lus10040954 9.1 0.9019
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Lus10018289 10.7 0.8967
AT2G31730 bHLH basic helix-loop-helix (bHLH) ... Lus10041649 11.7 0.9004
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Lus10027354 12.0 0.8554
AT4G12310 CYP706A5 "cytochrome P450, family 706, ... Lus10024580 13.7 0.8883
AT1G55200 Protein kinase protein with ad... Lus10041608 14.3 0.8876
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10018138 17.7 0.8893
Lus10021668 18.5 0.8509

Lus10007750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.