Lus10007771 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61470 169 / 6e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 169 / 3e-50 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 163 / 3e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 157 / 3e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 156 / 6e-46 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 153 / 6e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 151 / 9e-44 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G15920 149 / 6e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 144 / 3e-41 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 144 / 2e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042746 389 / 1e-136 AT5G10960 150 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029710 369 / 1e-128 AT5G10960 147 / 2e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029713 368 / 3e-128 AT5G10960 144 / 4e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 248 / 5e-81 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 243 / 8e-79 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 237 / 1e-75 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 234 / 2e-75 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 234 / 3e-75 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 228 / 3e-73 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 214 / 4e-68 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 160 / 3e-47 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G262500 159 / 1e-46 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 157 / 4e-46 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 151 / 5e-44 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 144 / 3e-41 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 142 / 2e-40 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 136 / 4e-38 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 132 / 1e-36 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 128 / 8e-35 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10007771 pacid=23165878 polypeptide=Lus10007771 locus=Lus10007771.g ID=Lus10007771.BGIv1.0 annot-version=v1.0
ATGGATCCACACATTCGCCAAGTCTGGAACTGGAATCTCCTGCCAGAGCTTGTAATCTTGGAACAAGCCCTTGGAAGCTACCCAATACTGAGTGTCGATT
GCGAGTTCCCTGGATTCCTGCGTCAAACGCCAAGAAATGCCACTGACACTCTCCGTTACGGTGACCTAAAACACAATGTGGACAGAACTCATATCATTCA
ACTCGGAGCCACTCTCTCCGACCACCACCGCATATTCGGAACTTGGCAATTCAATTTCGAGTTTGATCTCGGCAAAGATGTGCACACCAAAGAGACAGCC
GCTTTCTTGAAGGGTCACGGACTTGATTTCGAAAGCCACAAATCAGATGGTATCAAGAGGGCTCAATTCGCTGCTCAATTCTGCAGCATGTTGTCTCGCA
GAACACAACCTCTGAAATGGGTCACCTTCCATGGCCTCTATGATTTCGCCCATATCATGAAGATGCTTCTCAACGACACACCATTGCCTGGCATGTCTTC
CGGATTTAGAGACTTGTTGGGATGTTTGTTCGAGGAGATTGTCGATCTCAAGGTGATGGCCAAGTTCTGCGATGGCATTTCTGAAATGGAGGTTGGGTTG
CAAAAGCTGGCAGATTTGTTGAGCGTGAAGAGAGAGGGTGAAGCACATCAAGCTGGCTCTGATAGTTTGCTCACAGCATTGGTGTTTGTCAACATGAGAG
CAAGATTCCACCAACTTCAACAACATCTGTTTACTGATTACCTCTATGGAATCACTGAAAAGATTGGAAGGAAGCCAACCCCATCCTTTAGAGCTCATCA
CTACTCCTCCCGCCAATGGTTGTGCCACCAGCCGATGCCACTGCTCGTTCCGTGCTATCGTGCTTATCCTCCTCCTGCTGCTCAGTGTTTTGTTCTTCCC
CTGCATACCCCTTTCAGAATGCGTCAGTACTGA
AA sequence
>Lus10007771 pacid=23165878 polypeptide=Lus10007771 locus=Lus10007771.g ID=Lus10007771.BGIv1.0 annot-version=v1.0
MDPHIRQVWNWNLLPELVILEQALGSYPILSVDCEFPGFLRQTPRNATDTLRYGDLKHNVDRTHIIQLGATLSDHHRIFGTWQFNFEFDLGKDVHTKETA
AFLKGHGLDFESHKSDGIKRAQFAAQFCSMLSRRTQPLKWVTFHGLYDFAHIMKMLLNDTPLPGMSSGFRDLLGCLFEEIVDLKVMAKFCDGISEMEVGL
QKLADLLSVKREGEAHQAGSDSLLTALVFVNMRARFHQLQQHLFTDYLYGITEKIGRKPTPSFRAHHYSSRQWLCHQPMPLLVPCYRAYPPPAAQCFVLP
LHTPFRMRQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61470 Polynucleotidyl transferase, r... Lus10007771 0 1
AT3G50670 U1SNRNP, U1-70K U1 small nuclear ribonucleopro... Lus10026026 3.2 0.8233
AT5G09880 Splicing factor, CC1-like (.1) Lus10000826 4.9 0.8096
AT4G03500 Ankyrin repeat family protein ... Lus10026833 9.5 0.7940
AT1G09020 ATSNF4, SNF4 homolog of yeast sucrose nonfe... Lus10006516 10.1 0.7960
Lus10011007 21.1 0.8088
AT1G51610 Cation efflux family protein (... Lus10033367 21.4 0.7355
AT1G32730 unknown protein Lus10040132 21.6 0.8008
Lus10019128 21.8 0.7516
AT5G09880 Splicing factor, CC1-like (.1) Lus10002093 23.4 0.7592
AT3G19840 ATPRP40C pre-mRNA-processing protein 40... Lus10012908 26.3 0.7973

Lus10007771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.