Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) AT3G11230 116 / 6e-35 Yippee family putative zinc-binding protein (.1.2) AT3G08990 116 / 8e-35 Yippee family putative zinc-binding protein (.1.2) AT5G53940 116 / 9e-35 Yippee family putative zinc-binding protein (.1) AT2G40110 115 / 2e-34 Yippee family putative zinc-binding protein (.1.2) AT3G55890 113 / 9e-34 Yippee family putative zinc-binding protein (.1) AT4G27740 112 / 2e-33 Yippee family putative zinc-binding protein (.1) AT1G03910 39 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000335 [exp] 192 / 3e-65 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 192 / 3e-65 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10040190 [exp] 123 / 1e-37 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10028300 [exp] 123 / 2e-37 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10023244 [exp] 115 / 1e-34 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1) Lus10035531 [exp] 108 / 7e-32 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10013992 [exp] 108 / 1e-31 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10027762 [exp] 107 / 2e-31 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10015416 [exp] 107 / 3e-31 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G009200 [exp] 193 / 1e-65 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 193 / 1e-65 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 191 / 1e-64 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 175 / 2e-58 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.014G101600 [exp] 164 / 3e-54 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.012G019200 [exp] 125 / 1e-38 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.015G009100 [exp] 124 / 2e-38 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 124 / 9e-38 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 120 / 4e-36 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.006G015500 [exp] 119 / 5e-36 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10007773 pacid=23165875 polypeptide=Lus10007773 locus=Lus10007773.g ID=Lus10007773.BGIv1.0 annot-version=v1.0 ATGGCGGAATTTGCAGTAGGTCCTCGTCTGTACAGTTGCTGGAACTGCCGGAACCATGTCTCCCTTCACGACGATATAATCTCCAAGGCCTTTCAGGGAA GAAATGGGCGAGCTTTTCTGTTCTCGCACGCGATGAACGTATCGGTGGGGGTGAAAGAGGATCGGAATCTGATGACGGGACTCCACACAGTTGCAGACAT CTACTGCGGGGATTGCAAGGAGGTTTTGGGTTGGAAGTACGAGAGGGCTTACGAGGCTTCTCAGAAGTATAAAGAAGGCAAGTTCATTCTTGAGAAGTGC AAAATTGTCAAGGAGAACTGGTAG
AA sequence Show only first row Show all	>Lus10007773 pacid=23165875 polypeptide=Lus10007773 locus=Lus10007773.g ID=Lus10007773.BGIv1.0 annot-version=v1.0 MAEFAVGPRLYSCWNCRNHVSLHDDIISKAFQGRNGRAFLFSHAMNVSVGVKEDRNLMTGLHTVADIYCGDCKEVLGWKYERAYEASQKYKEGKFILEKC KIVKENW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27745			Yippee family putative zinc-bi...		Lus10007773 [exp]	0	1
AT1G15740			Leucine-rich repeat family pro...		Lus10038107 [exp]	1.4	0.9647
AT1G15740			Leucine-rich repeat family pro...		Lus10008036 [exp]	3.7	0.9578
AT2G26670		GUN2, ATHO1, TE...	REVERSAL OF THE DET PHENOTYPE ...		Lus10030092 [exp]	5.7	0.9544
AT2G26000		BRIZ2	BRAP2 RING ZnF UBP domain-cont...		Lus10035023 [exp]	6.6	0.9420
AT5G13800		CRN1, PPH	Co-regulated with NYE1, pheoph...		Lus10019755 [exp]	7.1	0.9577
AT2G38480			Uncharacterised protein family...		Lus10001266 [exp]	7.7	0.9236
AT2G40110			Yippee family putative zinc-bi...		Lus10040190 [exp]	8.6	0.9318
AT3G30390			Transmembrane amino acid trans...		Lus10031964 [exp]	8.9	0.9433
AT3G54480		SKP5, SKIP5	SKP1/ASK-interacting protein 5...		Lus10024168 [exp]	10.2	0.9417
AT4G37880			LisH/CRA/RING-U-box domains-co...		Lus10019837 [exp]	10.6	0.9443

Compare expression of checked genes

Lus10007773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.