Lus10007776 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039450 57 / 1e-10 ND /
Lus10038660 48 / 4e-07 AT5G36228 38 / 0.002 nucleic acid binding;zinc ion binding (.1)
Lus10035109 41 / 0.0003 AT4G24190 309 / 5e-98 SHEPHERD, HEAT SHOCK PROTEIN 90-7, Chaperone protein htpG family protein (.1.2)
Lus10005196 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007776 pacid=23165883 polypeptide=Lus10007776 locus=Lus10007776.g ID=Lus10007776.BGIv1.0 annot-version=v1.0
ATGGCACCCGATGGACCCATGAAATCAAATCCTTTTGTTGAGATTACCGTTGTCGATCCCCTAATCCCTGGCTTCCTCCTTGAAATCCCTAAAGCGCCGG
ACGAGAAGGTCATTTTCCGCTACGATCATTTGATTGAAGTTTGCAAGTTCTACGGGCGCATTGGCGACAACCTTGAGGATTGCCCCGAACGGCGGCTCTC
ATTGCACAAGGCTAATCTGGTGATCCCTCAGGCGACTCTGAAAACCTCTATGTGGAAGACTACATTGGCCAAGGGAACAATAGTGGCTCTGACGTTTCCT
CCTCCGACTTCAGCCTCCTCCTTCCTGCGTGACTACACACCCCTGGGCTCCAGCTCCACTCAGGCATCCAGCATAACCCAATCAAGACAGCAATCGTTGA
TGCTCCAGCTTCCAGTCGCGCGATCTTCCTTCAGACGACACGCTCAGCCTTACAGTGTTTATCTCCGGTTCAGAAGCCACACTTATGAGGTCTGCAGCGT
CTGGTATTTATTGACGCCGTGGGTTGCTCTCATCCAACCAAGAAGGTAA
AA sequence
>Lus10007776 pacid=23165883 polypeptide=Lus10007776 locus=Lus10007776.g ID=Lus10007776.BGIv1.0 annot-version=v1.0
MAPDGPMKSNPFVEITVVDPLIPGFLLEIPKAPDEKVIFRYDHLIEVCKFYGRIGDNLEDCPERRLSLHKANLVIPQATLKTSMWKTTLAKGTIVALTFP
PPTSASSFLRDYTPLGSSSTQASSITQSRQQSLMLQLPVARSSFRRHAQPYSVYLRFRSHTYEVCSVWYLLTPWVALIQPRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007776 0 1
AT2G23790 Protein of unknown function (D... Lus10022496 11.2 0.9047
AT5G36930 Disease resistance protein (TI... Lus10000153 18.0 0.8606
AT5G06570 alpha/beta-Hydrolases superfam... Lus10016204 25.9 0.8832
AT2G29350 SAG13 senescence-associated gene 13 ... Lus10024358 28.7 0.8828
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10000958 33.0 0.8379
AT5G36930 Disease resistance protein (TI... Lus10002247 36.7 0.8555
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028857 38.7 0.8214
Lus10031880 42.0 0.8649
AT1G21400 Thiamin diphosphate-binding fo... Lus10018945 46.3 0.8709
AT1G15190 Fasciclin-like arabinogalactan... Lus10003958 48.9 0.8483

Lus10007776 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.