Lus10007788 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53490 300 / 7e-104 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT1G12250 61 / 4e-11 Pentapeptide repeat-containing protein (.1.2)
AT2G44920 45 / 2e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G55000 40 / 0.0007 FIP2 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024602 64 / 9e-12 AT1G12250 354 / 1e-123 Pentapeptide repeat-containing protein (.1.2)
Lus10032239 62 / 4e-11 AT1G12250 357 / 9e-125 Pentapeptide repeat-containing protein (.1.2)
Lus10020270 50 / 8e-07 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10000520 44 / 5e-05 AT2G44920 286 / 6e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10002622 44 / 6e-05 AT5G55000 462 / 1e-165 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10002712 42 / 0.0002 AT2G44920 287 / 3e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G018100 330 / 1e-115 AT5G53490 318 / 1e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Potri.019G038400 44 / 3e-05 AT5G55000 414 / 1e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Potri.013G062500 43 / 0.0001 AT5G55000 413 / 2e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0505 Pentapeptide PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Representative CDS sequence
>Lus10007788 pacid=23165882 polypeptide=Lus10007788 locus=Lus10007788.g ID=Lus10007788.BGIv1.0 annot-version=v1.0
ATGGCGACTCTTTCTTTTTCTCTTCCACTTTCCAGAACCACCCCGGGCTCGTCGTCATCGTCAAAGCGAAATCCATTTCAGCCGCATCATTACCCTCGTG
CTAAAGTTACTTGTTCTTTCTCTCATAACGGAGCTGGATCAGAATCGGCCGGACCTCCAAGGATTCTTGGTTGGAAAGAAGTGAACTGTGTAGGTTGCGG
GTTTCTTGCTGCTCTCGCTGTCACTGCTTCTCCAGTAATTGCTGGAGCTCAGAGGCTACCCCCACTGTCGACAGAGCCCGACAGGTGCGAGAAGGCATAC
GTTGGAAACACGATTGGTCAAGCCAACGGCGTATATGATAAGCCAATTGATCTTCGGTTCTGCGATTTCAGTAACGACAAATCCAATCTCAAGGGGAAGT
CACTTGCTGCTGCACTAATGTCGGATGCTAAGTTTGATGGTGCTGACATGACAGAAGTCGTCATGTCCAAGGCTTACGCGGTTGGAGCTAGCTTCGTAGG
TGTGGACTTCTCAAACGCAGTTTTGGACCGTGTAAACTTTGGGAAGGCCAACCTGAAAGGAGCTGTGTTCAGGAACACTGTGCTGTCAGGGTCAACATTT
GAGGAGGCTGAAATGGGAGATGTGGTTTTTGAGGACACCATCATAGGCTACATCGACTTGCAGAAACTGTGTAGAAACACGAGTATCAGTGATGATGGAA
GGGCGGAATTGGGATGTAGATGA
AA sequence
>Lus10007788 pacid=23165882 polypeptide=Lus10007788 locus=Lus10007788.g ID=Lus10007788.BGIv1.0 annot-version=v1.0
MATLSFSLPLSRTTPGSSSSSKRNPFQPHHYPRAKVTCSFSHNGAGSESAGPPRILGWKEVNCVGCGFLAALAVTASPVIAGAQRLPPLSTEPDRCEKAY
VGNTIGQANGVYDKPIDLRFCDFSNDKSNLKGKSLAAALMSDAKFDGADMTEVVMSKAYAVGASFVGVDFSNAVLDRVNFGKANLKGAVFRNTVLSGSTF
EEAEMGDVVFEDTIIGYIDLQKLCRNTSISDDGRAELGCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53490 Tetratricopeptide repeat (TPR)... Lus10007788 0 1
AT3G45050 unknown protein Lus10041331 1.0 0.9701
AT5G42765 unknown protein Lus10032714 2.2 0.9530
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10035036 4.5 0.9612
AT4G23890 NdhS, CRR31 NADH dehydrogenase-like comple... Lus10001826 5.3 0.9495
AT5G45680 ATFKBP13 FK506 BINDING PROTEIN 13, FK50... Lus10006949 5.7 0.9608
AT4G29590 S-adenosyl-L-methionine-depend... Lus10040550 6.0 0.9574
AT5G53850 haloacid dehalogenase-like hyd... Lus10041928 7.3 0.9523
AT5G62960 unknown protein Lus10039964 9.9 0.9379
AT2G35500 SKL2 shikimate kinase-like 2, shiki... Lus10030990 11.6 0.9389
AT3G46780 PTAC16 plastid transcriptionally acti... Lus10040768 12.0 0.9479

Lus10007788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.