Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16640 84 / 2e-20 Matrixin family protein (.1) AT2G45040 83 / 4e-20 Matrixin family protein (.1) AT1G70170 65 / 2e-13 MMP matrix metalloproteinase (.1) AT1G24140 62 / 2e-12 Matrixin family protein (.1) AT1G59970 59 / 1e-11 Matrixin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004728 [exp] 136 / 5e-40 AT4G16640 350 / 2e-119 Matrixin family protein (.1) Lus10007478 [exp] 109 / 9e-30 AT4G16640 345 / 2e-117 Matrixin family protein (.1) Lus10028955 [exp] 103 / 1e-27 AT4G16640 360 / 3e-123 Matrixin family protein (.1) Lus10028180 [exp] 79 / 5e-19 AT2G45040 278 / 9e-93 Matrixin family protein (.1) Lus10042881 [exp] 72 / 4e-17 AT2G45040 180 / 1e-56 Matrixin family protein (.1) Lus10030662 [exp] 50 / 2e-08 AT1G59970 338 / 9e-115 Matrixin family protein (.1) Lus10029207 [exp] 47 / 3e-07 AT1G70170 131 / 1e-43 matrix metalloproteinase (.1) Lus10032175 [exp] 43 / 1e-05 AT1G59970 224 / 3e-71 Matrixin family protein (.1) Lus10014512 [exp] 41 / 3e-05 AT1G59970 221 / 6e-70 Matrixin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G157500 [exp] 84 / 1e-20 AT2G45040 349 / 2e-119 Matrixin family protein (.1) Potri.003G077400 [exp] 82 / 1e-19 AT2G45040 330 / 1e-110 Matrixin family protein (.1) Potri.014G058200 [exp] 73 / 1e-16 AT2G45040 358 / 3e-123 Matrixin family protein (.1) Potri.012G104600 [exp] 69 / 7e-15 AT1G24140 393 / 5e-136 Matrixin family protein (.1) Potri.015G103900 [exp] 66 / 7e-14 AT1G24140 381 / 3e-131 Matrixin family protein (.1) Potri.013G100400 [exp] 51 / 8e-09 AT1G59970 247 / 4e-80 Matrixin family protein (.1) Potri.013G033200 [exp] 49 / 6e-08 AT1G24140 246 / 2e-79 Matrixin family protein (.1) Potri.019G073400 [exp] 46 / 6e-07 AT1G70170 215 / 2e-67 matrix metalloproteinase (.1) Potri.008G027900 [exp] 45 / 1e-06 AT1G59970 192 / 9e-59 Matrixin family protein (.1) Potri.008G027600 [exp] 44 / 3e-06 AT1G59970 213 / 8e-67 Matrixin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [flax] [poplar] Peptidase_MA PF00413 [flax] [poplar] Peptidase_M10 Matrixin
Representative CDS sequence Show only first row Show all	>Lus10007791 pacid=23143568 polypeptide=Lus10007791 locus=Lus10007791.g ID=Lus10007791.BGIv1.0 annot-version=v1.0 ATGCCTCCTACAGTCCTCTGGTGTCTCGTCTCTCTGTGTTCCGCCCGGGCACAGTGGCGGCGGGGCCGTTCGACGATGACGCTGACGTACGCCTTTTCGC CGGGGCACATGGTCCGGTACATAAGCGGGGAGGAGGTACGAAAAGTTTTCAGGCGGGCGTTCGCGCGGTGGTCGGCGGTGATTCCGGTGGCCTTCCGGGA GTCGGAGGACTACCGGTCGACGGACATCCGGATCGGGTGGTACCGCGGGGACCACGGGCGTACGGCCGTATTTCACAACCACGGGTGTACGGCCGTATTT CACAATAAATAA
AA sequence Show only first row Show all	>Lus10007791 pacid=23143568 polypeptide=Lus10007791 locus=Lus10007791.g ID=Lus10007791.BGIv1.0 annot-version=v1.0 MPPTVLWCLVSLCSARAQWRRGRSTMTLTYAFSPGHMVRYISGEEVRKVFRRAFARWSAVIPVAFRESEDYRSTDIRIGWYRGDHGRTAVFHNHGCTAVF HNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45040			Matrixin family protein (.1)		Lus10007791 [exp]	0	1
AT1G19715			Mannose-binding lectin superfa...		Lus10024291 [exp]	1.4	0.8550
AT3G11280	MYB		Duplicated homeodomain-like su...		Lus10014837 [exp]	6.9	0.7895
AT5G05340			Peroxidase superfamily protein...		Lus10009932 [exp]	12.7	0.7325
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Lus10040108 [exp]	13.0	0.7435
AT2G45910			U-box domain-containing protei...		Lus10040825 [exp]	14.7	0.7472
AT4G15450			Senescence/dehydration-associa...		Lus10034970 [exp]	17.4	0.7709
					Lus10039327 [exp]	21.9	0.7044
					Lus10035928 [exp]	26.5	0.7156
					Lus10032559 [exp]	27.9	0.7091
AT1G48480		RKL1	receptor-like kinase 1 (.1)		Lus10010973 [exp]	28.8	0.7199

Compare expression of checked genes

Lus10007791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.