Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 240 / 5e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 199 / 6e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G35190 191 / 6e-59 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46480 151 / 5e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 130 / 4e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 102 / 5e-25 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 102 / 8e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G50210 102 / 8e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT1G06650 98 / 4e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004746 [exp] 489 / 6e-176 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10034964 [exp] 231 / 5e-74 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10012963 [exp] 226 / 5e-72 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 187 / 2e-57 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 186 / 4e-56 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10032930 [exp] 103 / 3e-25 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 102 / 1e-24 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 99 / 2e-23 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10030185 [exp] 97 / 8e-23 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G079600 [exp] 389 / 7e-137 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G086800 [exp] 249 / 2e-81 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086900 [exp] 228 / 5e-73 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.007G047100 [exp] 108 / 2e-27 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.015G002800 [exp] 100 / 2e-24 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G231500 [exp] 100 / 9e-24 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G107600 [exp] 99 / 1e-23 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G128100 [exp] 99 / 1e-23 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 97 / 4e-23 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.012G006300 [exp] 97 / 5e-23 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10007820 pacid=23143570 polypeptide=Lus10007820 locus=Lus10007820.g ID=Lus10007820.BGIv1.0 annot-version=v1.0 ATGGCAGTACCTGTCGCGAAACTCCCAGTCATAGACCTCTCCTCTCCCGATAGAGTATCCACCGCCGAGTTGATTCGTAAGGCGTGCATCGACTATGGCT TCTTCTACCTTGCGAATCACGGAGTGGAAGAAGAACTGATCCGGAGAGTGTTCGAAGAGAGCCGTAAGTTCTTCTCGCTCCCGGTGGATGAGAAATCGAA GCTGCCTCGCAAAAATCACAGGGGATACACTGCTTTGTACGCCGAGAATCTCGATCCCGATTCCAGCTCCAGAGGCGACTCGAAGGAGAGCTTCTACGTT GGTCCAATAGACGGCAATAAAGCTGAGCTGAACCAGTGGCCTTCTGAAATTTCAGAAGTTCTTCCTTCATGGAGGTTCACGCTCGAGTCTTACTACGGAA AAGTCATGTCAGCTGGAATAAGATTGATCTCCTTAATTGCTCTGGCTTTGAATTTGGACGAAAATCACTTTCAGAAGATTGGAGCCTTGGATGAACCAGA AGCATTCCTTCGACTCATACATTATCCAGGTGAACTGGGCTGTTCGAATGAAGAGCTGTATGGTGCTTCTGCACATTCAGACTATGGAATGATCACATTA CTCATAGATGACGGGGTACCAGGACTCCAGGCATGTGTTGCTAAATTCGTTTGTAGGGAGAAGTCAAGACAACCTAGGGTATGGGAAGATGTGCCGCACT TACACGGGTGCTTCATTGTTAACATTGGAGACATGATGGAGAGGTGGACAAATTGCTTGTTCCGATGGCATGCTTCTTCGATCCTAACCCGGATTGCATC ATTGAGTGCTTGGAGAGTTGCTGCAGCATGTCTTCTCCTCCAAGGTACTCTTTTAAAATCCGAATCCTCCCTCATTACAGCTTTCTCTTTAACGCCCTTC TTTACTACTTGA
AA sequence Show only first row Show all	>Lus10007820 pacid=23143570 polypeptide=Lus10007820 locus=Lus10007820.g ID=Lus10007820.BGIv1.0 annot-version=v1.0 MAVPVAKLPVIDLSSPDRVSTAELIRKACIDYGFFYLANHGVEEELIRRVFEESRKFFSLPVDEKSKLPRKNHRGYTALYAENLDPDSSSRGDSKESFYV GPIDGNKAELNQWPSEISEVLPSWRFTLESYYGKVMSAGIRLISLIALALNLDENHFQKIGALDEPEAFLRLIHYPGELGCSNEELYGASAHSDYGMITL LIDDGVPGLQACVAKFVCREKSRQPRVWEDVPHLHGCFIVNIGDMMERWTNCLFRWHASSILTRIASLSAWRVAAACLLLQGTLLKSESSLITAFSLTPF FTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16770			2-oxoglutarate (2OG) and Fe(II...		Lus10007820 [exp]	0	1
AT3G26880			Plant self-incompatibility pro...		Lus10025937 [exp]	7.1	0.8474
AT5G65880			unknown protein		Lus10039652 [exp]	10.2	0.8456
AT5G13240			transcription regulators (.1)		Lus10007961 [exp]	10.5	0.8505
AT3G16190			Isochorismatase family protein...		Lus10037581 [exp]	16.0	0.8230
AT1G20693		HMGBETA1, NFD2,...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10013219 [exp]	18.5	0.8406
AT3G16990			Haem oxygenase-like, multi-hel...		Lus10016885 [exp]	20.0	0.8474
AT5G10650			RING/U-box superfamily protein...		Lus10042443 [exp]	26.6	0.7955
AT2G39000			Acyl-CoA N-acyltransferases (N...		Lus10040401 [exp]	27.4	0.8437
AT2G16720	MYB	AtY49, AtMYB7	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10028435 [exp]	27.6	0.8469
AT4G37020			unknown protein		Lus10000435 [exp]	32.5	0.8148

Compare expression of checked genes

Lus10007820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.