Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007835 pacid=23143601 polypeptide=Lus10007835 locus=Lus10007835.g ID=Lus10007835.BGIv1.0 annot-version=v1.0 ATGGAACCTTCCAATGTGATGTCCTCGACTAGCTTCTTGGTGAATGCGTTAGAGTTTACGGTGTTGAAGGATCTTCGTCGTGTTTGTTTATGTCGTGAAT GCGTTAGAGAGTTTACGATTTCAAAGGATAGAAAAGCAGATGTAATGTACTGGTTGAAGGAAACATTATTTAAGCAAGCTAGGTAG
AA sequence Show only first row Show all	>Lus10007835 pacid=23143601 polypeptide=Lus10007835 locus=Lus10007835.g ID=Lus10007835.BGIv1.0 annot-version=v1.0 MEPSNVMSSTSFLVNALEFTVLKDLRRVCLCRECVREFTISKDRKADVMYWLKETLFKQAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007835 [exp]	0	1
AT1G15170			MATE efflux family protein (.1...		Lus10042732 [exp]	3.5	0.6462
AT5G62310		IRE	INCOMPLETE ROOT HAIR ELONGATIO...		Lus10038912 [exp]	9.4	0.7101
AT1G11390			Protein kinase superfamily pro...		Lus10002591 [exp]	29.6	0.6239
AT3G49190			O-acyltransferase (WSD1-like) ...		Lus10033678 [exp]	32.0	0.6317
					Lus10032910 [exp]	35.0	0.6171
AT1G58025			DNA-binding bromodomain-contai...		Lus10035797 [exp]	69.1	0.5751
					Lus10021760 [exp]	93.3	0.5243
AT1G58520		RXW8	lipases;hydrolases, acting on ...		Lus10036752 [exp]	111.0	0.5258
AT2G34440	MADS	AGL29	AGAMOUS-like 29 (.1)		Lus10016563 [exp]	119.2	0.5281
AT1G25240			ENTH/VHS/GAT family protein (....		Lus10019132 [exp]	122.5	0.5434

Compare expression of checked genes

Lus10007835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.