Lus10007839 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60750 50 / 8e-08 Transketolase (.1.2)
AT2G45290 0 / 1 Transketolase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004750 67 / 1e-08 AT2G45290 1054 / 0.0 Transketolase (.1)
Lus10031708 52 / 3e-08 AT3G60750 1255 / 0.0 Transketolase (.1.2)
Lus10000789 43 / 4e-05 AT2G45290 1106 / 0.0 Transketolase (.1)
Lus10030283 42 / 8e-05 AT2G45290 1121 / 0.0 Transketolase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G068200 52 / 3e-08 AT2G45290 1174 / 0.0 Transketolase (.1)
Potri.002G146300 0 / 1 AT2G45290 1180 / 0.0 Transketolase (.1)
PFAM info
Representative CDS sequence
>Lus10007839 pacid=23143605 polypeptide=Lus10007839 locus=Lus10007839.g ID=Lus10007839.BGIv1.0 annot-version=v1.0
ATGAGCACAAATACGGGGAAGAAGCTGCAGTGCTCAAGTCTATCATCACTAGTGAACTGCCCACTGGTTGGGAGAATGCATTACCTGCTAGCTGAGCCAA
GCCGACCAAGGTTCTTCCTCCGGTTTGAGCTTCGGCTCGTTTATTTCTTGTCGAGCTATATAAAAGCCCGACTCAACGAGCTCATGAGCCTGTCGAGCCG
AGCCAAGACTTACACTCCGGATAGCCCAGCTGACGCCATAAGAGCACTATCACAGCGCACCTTAAACTCCCTCGCCGACGTTCTCCCAGCATTCGCCGGC
GCTGCCGCCGACCTCGCCTCATCGAACTTAAGCGTGATGAAGAAATTCGGAGACTTCCAGAAACTCACGCCGGAGGATGGTTGGGAGCAAAGGGAAGTCG
ATCGGAATCGATCGGCTTGGTGCGAGTGCCCCGCTACCTGTGGTGTATGA
AA sequence
>Lus10007839 pacid=23143605 polypeptide=Lus10007839 locus=Lus10007839.g ID=Lus10007839.BGIv1.0 annot-version=v1.0
MSTNTGKKLQCSSLSSLVNCPLVGRMHYLLAEPSRPRFFLRFELRLVYFLSSYIKARLNELMSLSSRAKTYTPDSPADAIRALSQRTLNSLADVLPAFAG
AAADLASSNLSVMKKFGDFQKLTPEDGWEQREVDRNRSAWCECPATCGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60750 Transketolase (.1.2) Lus10007839 0 1
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10009231 7.5 0.6527
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10039050 13.0 0.6352
AT1G55460 C2H2ZnF DNA/RNA-binding protein Kin17,... Lus10012271 14.1 0.6063
Lus10010411 26.3 0.5549
AT1G56260 MDO1 MERISTEM DISORGANIZATION 1, un... Lus10029875 26.5 0.5586
AT2G34930 disease resistance family prot... Lus10033931 32.0 0.6271
AT3G28860 ABCB19, ATMDR11... P-GLYCOPROTEIN 19, MULTIDRUG R... Lus10015595 33.2 0.5979
AT4G02610 Aldolase-type TIM barrel famil... Lus10014725 36.3 0.5545
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10023363 44.0 0.5953
AT5G59100 Subtilisin-like serine endopep... Lus10040751 45.0 0.5700

Lus10007839 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.