Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 86 / 4e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 80 / 6e-22 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004754 [exp] 119 / 1e-37 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10001641 [exp] 95 / 6e-28 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10000059 [exp] 94 / 2e-27 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10016473 [exp] 94 / 2e-27 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 94 / 3e-27 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146602 [exp] 84 / 2e-23 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.006G077500 [exp] 83 / 4e-23 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.018G145502 [exp] 80 / 6e-22 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [flax] [poplar] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Lus10007843 pacid=23143595 polypeptide=Lus10007843 locus=Lus10007843.g ID=Lus10007843.BGIv1.0 annot-version=v1.0 ATGGCGATCATCAGCGAGAAGTTAACGGGGTGGAAATCCAAAGCTCAGAGCTTGAAAGAGTGGACCGACTGGAGCTTGCAGAAGGCGAAAGTCGTGGCTC ACTACGGATTCATCCCTCTCATCATCGTCGTCGGCATGAACTCCGAGCCCAAGCCTCAGCTCTACCAGCTGCTCAGCCCTGTTTGA
AA sequence Show only first row Show all	>Lus10007843 pacid=23143595 polypeptide=Lus10007843 locus=Lus10007843.g ID=Lus10007843.BGIv1.0 annot-version=v1.0 MAIISEKLTGWKSKAQSLKEWTDWSLQKAKVVAHYGFIPLIIVVGMNSEPKPQLYQLLSPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41685			Mitochondrial outer membrane t...		Lus10007843 [exp]	0	1
AT5G59970			Histone superfamily protein (....		Lus10041919 [exp]	1.0	0.9724
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10005892 [exp]	5.7	0.9628
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10040853 [exp]	6.0	0.9628
AT5G28640		ATGIF1, GIF1, A...	ARABIDOPSIS GRF1-INTERACTING F...		Lus10005524 [exp]	11.0	0.9557
AT3G18960	B3		AP2/B3-like transcriptional fa...		Lus10012046 [exp]	14.3	0.9677
AT3G10610			Ribosomal S17 family protein (...		Lus10016985 [exp]	20.0	0.9129
AT3G27360			Histone superfamily protein (....		Lus10013948 [exp]	20.3	0.9523
AT4G22320			unknown protein		Lus10043179 [exp]	21.1	0.9020
AT4G37580		UNS2, COP3, HLS...	UNUSUAL SUGAR RESPONSE 2, HOOK...		Lus10016904 [exp]	22.8	0.9566
AT2G20815		QWRF3	QWRF domain containing 3, Fami...		Lus10039786 [exp]	28.0	0.9535

Compare expression of checked genes

Lus10007843 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.