Lus10007844 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47310 253 / 2e-85 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 252 / 2e-85 PPPDE putative thiol peptidase family protein (.1.2)
AT1G47740 216 / 2e-70 PPPDE putative thiol peptidase family protein (.1.2)
AT2G25190 209 / 3e-68 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 206 / 2e-67 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 200 / 6e-65 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 198 / 2e-59 unknown protein
AT4G25680 87 / 1e-20 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 85 / 9e-20 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 60 / 8e-11 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004755 380 / 8e-136 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 333 / 3e-117 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 290 / 4e-96 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10043293 220 / 2e-72 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10013657 216 / 3e-71 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 217 / 4e-71 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 216 / 5e-71 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 215 / 2e-70 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 211 / 2e-69 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G080300 279 / 7e-96 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 276 / 7e-95 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.T126004 221 / 1e-72 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 219 / 3e-72 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 219 / 6e-72 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 218 / 8e-72 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 218 / 8e-72 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G180400 211 / 3e-69 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.006G154400 211 / 3e-69 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 210 / 7e-69 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10007844 pacid=23143563 polypeptide=Lus10007844 locus=Lus10007844.g ID=Lus10007844.BGIv1.0 annot-version=v1.0
ATGCATTTCTTCCCTTTCAGCTCAAGCTCACACAAGGATGGCGGGAGTCGTGTTCCGGTGTATTTGAACGTGTACGATCTCACCACTGTGAATAATTACC
TCTATTGGCTCGGCCTCGGCATCTTCCATTCCGGCATTGAAGTCCATGGAATGGAGTTCAGTTTCGGAGCACACGAGTACCCTAGCAGTGGGATATTTGA
GGTGCAACCACGGAGTTGTCCAGGCTTCATCTTCCGACGAGCAGTGTTGCTTGGCAAGACCAGCTTGTCACGCTCAGAAGTTCAGGAGATGATGGAGCAT
ATCTCGGCCGACTTCCATGGTGACTGTTATCACTTGATCTCCAAGAACTGCAATCACTTCACAGATGAAGCTTGCTTGAAACTAACGGGGAAGGCTGTCC
CTGGATGGGTAAATCGGTTGGCTCGATTAGGTTCTTTCTGCAATTGTCTACTACCAGAAAGCATTAAGGTTGCACCAGTTCAACATTTACCTGAACGAGC
AGCACATAACGATGACGACGATGCCACAGCATCAATCCTATCATCTGCCTCGTTGGCAAGCGACGAAGATAACTCGAATCAGCATCTCTTGCCCATACCC
AACGCCGAAGTCTCGTTTGTAAAGGAAAAACCTATCGACCCATCAGGCTAG
AA sequence
>Lus10007844 pacid=23143563 polypeptide=Lus10007844 locus=Lus10007844.g ID=Lus10007844.BGIv1.0 annot-version=v1.0
MHFFPFSSSSHKDGGSRVPVYLNVYDLTTVNNYLYWLGLGIFHSGIEVHGMEFSFGAHEYPSSGIFEVQPRSCPGFIFRRAVLLGKTSLSRSEVQEMMEH
ISADFHGDCYHLISKNCNHFTDEACLKLTGKAVPGWVNRLARLGSFCNCLLPESIKVAPVQHLPERAAHNDDDDATASILSSASLASDEDNSNQHLLPIP
NAEVSFVKEKPIDPSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10007844 0 1
AT2G34660 EST4, ATMRP2, A... Arabidopsis thaliana ATP-bindi... Lus10038530 11.0 0.9182
AT3G62150 ABCB21, PGP21 ATP-binding cassette B21, P-gl... Lus10038049 12.0 0.9253
AT4G31420 C2H2ZnF Zinc finger protein 622 (.1.2) Lus10026949 16.5 0.9156
AT4G15420 Ubiquitin fusion degradation U... Lus10031538 20.2 0.8772
AT4G35240 Protein of unknown function (D... Lus10023949 22.8 0.8632
AT1G73160 UDP-Glycosyltransferase superf... Lus10014499 29.9 0.8787
AT3G24170 ATGR1 glutathione-disulfide reductas... Lus10000758 30.0 0.9131
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10019915 30.0 0.8983
AT1G30620 MURUS4, HSR8, U... UDP-D-XYLOSE 4-EPIMERASE 1, MU... Lus10013107 35.9 0.9030
AT4G02380 SAG21, ATLEA5 Arabidopsis thaliana late embr... Lus10008170 43.4 0.9019

Lus10007844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.