Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 124 / 2e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 114 / 1e-30 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72930 110 / 1e-30 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72950 112 / 2e-29 Disease resistance protein (TIR-NBS class) (.1) AT1G72940 111 / 7e-29 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 108 / 6e-28 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72910 105 / 8e-27 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72890 105 / 3e-26 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G17615 102 / 2e-25 Disease resistance protein (TIR-NBS class) (.1) AT5G48780 99 / 7e-24 disease resistance protein (TIR-NBS class) (.1), disease resistance protein (TIR-NBS class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010987 [exp] 394 / 1e-141 AT5G36930 122 / 7e-32 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007811 [exp] 209 / 3e-62 AT5G36930 376 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10000331 [exp] 207 / 1e-61 AT5G36930 217 / 1e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007808 [exp] 207 / 2e-61 AT5G36930 418 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004727 [exp] 194 / 1e-60 AT1G27180 182 / 2e-53 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10008526 [exp] 200 / 5e-59 AT5G36930 361 / 5e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008519 [exp] 192 / 3e-56 AT1G27180 344 / 2e-98 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10002247 [exp] 192 / 3e-56 AT5G36930 363 / 1e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10002249 [exp] 189 / 3e-55 AT5G36930 286 / 2e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G001314 [exp] 124 / 7e-35 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 127 / 3e-34 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 127 / 4e-34 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 128 / 5e-34 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 127 / 1e-33 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 127 / 2e-33 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 126 / 3e-33 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G046000 [exp] 124 / 8e-33 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G007884 [exp] 124 / 1e-32 AT5G36930 654 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 123 / 1e-32 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10007852 pacid=23143566 polypeptide=Lus10007852 locus=Lus10007852.g ID=Lus10007852.BGIv1.0 annot-version=v1.0 ATGGATTACTACATGAGAGTAGGTGTGACAGTTGCCGCCACATTGCTTCCAGTGCTCATAACAATGTTCTACAAGTGGTTCTCCAGAAGGCGGAATTCGA ATTCCGCCTCGAATTCACCGGCCCTCCCCTCTACAGACTACAAGGTGTTTTTAAGCTTTAAAGGTCCAGACGCTCATCAATTCGTCGACATTCTTTACCG TATCCTACTTAGGGCAAATATCCGCACATTCAAAGACGACAAGGAACTTCTCAAAGGGGAGGGACTGTCCCCCGAGACCAGCAAGGCTATCGACCAGTGC AAAATATTTGTGGTGGTCGTGTCGAAAAACTATGCTAACGACACGAGGTGCCTCAGGGAGCTCGTCGAGATCTCAGAACGTCAGAAGCAGGATAACCGAC GTGTCATACTTCCAATTTTCTATATGATGGATCCAAAGAGCGTGAAATTCCTTATAGGACCTTATCAGAACTCGTTTACGGTGCACCACAGGAACTTCCC TGAAGCTACCGTACAGAGCTGGAAAATCGCTTTGAGTGACCTCGGATCGCTCAAGGGCTGGCAAGTCAAAAGCGAGAACGAGCATGGTGCTGTAGCAGAC CATGTTTCTGGGGATATACGGTCACAGCTGAGCAAGAACAACAATAATGGTGGAGACTGA
AA sequence Show only first row Show all	>Lus10007852 pacid=23143566 polypeptide=Lus10007852 locus=Lus10007852.g ID=Lus10007852.BGIv1.0 annot-version=v1.0 MDYYMRVGVTVAATLLPVLITMFYKWFSRRRNSNSASNSPALPSTDYKVFLSFKGPDAHQFVDILYRILLRANIRTFKDDKELLKGEGLSPETSKAIDQC KIFVVVVSKNYANDTRCLRELVEISERQKQDNRRVILPIFYMMDPKSVKFLIGPYQNSFTVHHRNFPEATVQSWKIALSDLGSLKGWQVKSENEHGAVAD HVSGDIRSQLSKNNNNGGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10007852 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10010987 [exp]	1.0	0.9948
AT1G79910			Regulator of Vps4 activity in ...		Lus10025779 [exp]	1.7	0.9797
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	2.0	0.9843
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10000180 [exp]	2.2	0.9763
AT1G27180			disease resistance protein (TI...		Lus10007831 [exp]	2.4	0.9759
AT5G36930			Disease resistance protein (TI...		Lus10004726 [exp]	3.5	0.9780
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006306 [exp]	4.6	0.9519
					Lus10035048 [exp]	6.3	0.9699
AT4G37445			unknown protein		Lus10001408 [exp]	7.0	0.9702
AT1G54400			HSP20-like chaperones superfam...		Lus10032902 [exp]	7.1	0.9676

Compare expression of checked genes

Lus10007852 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.