Lus10007864 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01575 89 / 2e-23 serine protease inhibitor, Kazal-type family protein (.1)
AT3G61980 87 / 4e-23 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030166 179 / 6e-59 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010285 65 / 2e-14 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010287 64 / 4e-14 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010094 61 / 6e-13 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009866 61 / 1e-12 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010286 54 / 1e-10 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1)
Lus10030164 53 / 4e-10 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009865 48 / 5e-08 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G108600 112 / 1e-32 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.002G182800 98 / 6e-27 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.015G001800 82 / 8e-21 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G109000 67 / 2e-15 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108900 66 / 4e-15 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108700 64 / 2e-14 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108800 52 / 9e-10 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence
>Lus10007864 pacid=23143173 polypeptide=Lus10007864 locus=Lus10007864.g ID=Lus10007864.BGIv1.0 annot-version=v1.0
ATGAGGCGAGCCACGAGGTCGTGGATCGCGATTCCGGCGTCGTTATTGCTGCTGTTGTTGCTGTTGTGTGTTTGCTCATCTCTGTCCGCAGTGGTGGCGC
AATCGGAAGAGAAGGTGATTCATCAAGTTACGGAGAAAGAATCCGGCGACGTATGCGGTGGTTCGTCTGTTCCTCCGGCGGCGTCCTCGTGCCCGATCAA
CTGCTTCCGTGCCGATCCGGTCTGCGGCGTCGACGGCGTCACGTACTGGTGCGGATGCGCCGACGCTGCGTGCCATGGGACTAAGGTGGCGAAGCTAGGA
GCGTGCGAGGTCGGAAGCGGAGGCAGCACCGCTTCCCTCCCTGGTCAGGCGCTCCTCCTTGTTCACATCGTTTGGCTCTTCTTGCTCGGCTTCTCTTTGC
TGTTCGGCCTCTTCTGA
AA sequence
>Lus10007864 pacid=23143173 polypeptide=Lus10007864 locus=Lus10007864.g ID=Lus10007864.BGIv1.0 annot-version=v1.0
MRRATRSWIAIPASLLLLLLLLCVCSSLSAVVAQSEEKVIHQVTEKESGDVCGGSSVPPAASSCPINCFRADPVCGVDGVTYWCGCADAACHGTKVAKLG
ACEVGSGGSTASLPGQALLLVHIVWLFLLGFSLLFGLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G01575 serine protease inhibitor, Kaz... Lus10007864 0 1
Lus10016421 3.0 0.8435
Lus10024338 3.9 0.8189
AT5G64020 TBL14 TRICHOME BIREFRINGENCE-LIKE 14... Lus10037877 6.5 0.8306
AT3G16180 Major facilitator superfamily ... Lus10014537 7.5 0.7972
AT1G02000 GAE2 UDP-D-glucuronate 4-epimerase ... Lus10027195 8.5 0.8072
AT1G59970 Matrixin family protein (.1) Lus10030662 11.8 0.8187
AT1G57680 unknown protein Lus10008842 12.2 0.7874
AT2G39290 PGP1, PGS1, PGP... phosphatidylglycerolphosphate ... Lus10023471 12.4 0.7840
AT3G10300 Calcium-binding EF-hand family... Lus10042037 20.8 0.7721
AT5G40150 Peroxidase superfamily protein... Lus10039471 22.0 0.7915

Lus10007864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.