Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02860 74 / 2e-16 BAH1, NLA nitrogen limitation adaptation, BENZOIC ACID HYPERSENSITIVE 1, SPX (SYG1/Pho81/XPR1) domain-containing protein (.1), SPX (SYG1/Pho81/XPR1) domain-containing protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030375 [exp] 107 / 5e-29 AT1G02860 386 / 1e-134 nitrogen limitation adaptation, BENZOIC ACID HYPERSENSITIVE 1, SPX (SYG1/Pho81/XPR1) domain-containing protein (.1), SPX (SYG1/Pho81/XPR1) domain-containing protein (.2) Lus10015986 [exp] 40 / 0.0002 AT2G38920 389 / 1e-135 SPX (SYG1/Pho81/XPR1) domain-containing protein / zinc finger (C3HC4-type RING finger) protein-related Lus10012290 [exp] 39 / 0.0003 AT2G38920 392 / 5e-137 SPX (SYG1/Pho81/XPR1) domain-containing protein / zinc finger (C3HC4-type RING finger) protein-related
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G130300 [exp] 74 / 1e-16 AT1G02860 448 / 3e-159 nitrogen limitation adaptation, BENZOIC ACID HYPERSENSITIVE 1, SPX (SYG1/Pho81/XPR1) domain-containing protein (.1), SPX (SYG1/Pho81/XPR1) domain-containing protein (.2) Potri.002G205400 [exp] 72 / 9e-16 AT1G02860 437 / 5e-155 nitrogen limitation adaptation, BENZOIC ACID HYPERSENSITIVE 1, SPX (SYG1/Pho81/XPR1) domain-containing protein (.1), SPX (SYG1/Pho81/XPR1) domain-containing protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007868 pacid=23143200 polypeptide=Lus10007868 locus=Lus10007868.g ID=Lus10007868.BGIv1.0 annot-version=v1.0 ATGAAGTTCTGCAAGAAATACCAGGAGTACATGAAAGGGCAGGATGATCAGGAGACACAACAGCTGCCTCGCCTGGGTTTCAACAACCTCGAGAAGCTAC TCAAGTGCTGCAGATCACACAACCGCGGCGGCGGTGGATGCTCTTGCTCCGGCTGTGATGATAAGTTCTTCGCTTCATTGGTGGAGGAGACGTCGAGCAT AGTGAGTTGCTTCAATCAGCAAGCTCAGAGGTTGATGGATCTCCATCTCGGATCCTCTGGTTTCAGGAGATGCTTGATTTGGTTCACTGCCAAGCTGCGA GGTAGTCCTAACCTTTTGCTTTCACTCTGTGTCTCAGATTCATTACTCAAAGCAAGGGCAAGCATTTAA
AA sequence Show only first row Show all	>Lus10007868 pacid=23143200 polypeptide=Lus10007868 locus=Lus10007868.g ID=Lus10007868.BGIv1.0 annot-version=v1.0 MKFCKKYQEYMKGQDDQETQQLPRLGFNNLEKLLKCCRSHNRGGGGCSCSGCDDKFFASLVEETSSIVSCFNQQAQRLMDLHLGSSGFRRCLIWFTAKLR GSPNLLLSLCVSDSLLKARASI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02860		BAH1, NLA	nitrogen limitation adaptation...		Lus10007868 [exp]	0	1
AT4G26700		ATFIM1	ARABIDOPSIS THALIANA FIMBRIN 1...		Lus10016580 [exp]	14.7	0.6759
AT1G08320	bZIP	TGA9, bZIP21	TGACG \(TGA\) motif-binding pr...		Lus10019543 [exp]	19.7	0.6573
AT3G10360		APUM4	pumilio 4 (.1)		Lus10038706 [exp]	26.3	0.6430
AT5G14940			Major facilitator superfamily ...		Lus10039465 [exp]	73.7	0.5975
AT3G07630		AtADT2, ADT2	Arabidopsis thaliana arogenate...		Lus10036135 [exp]	83.2	0.6069
AT3G12770		MEF22	mitochondrial editing factor ...		Lus10000706 [exp]	86.0	0.6082
AT5G52290		SHOC1	shortage in chiasmata 1 (.1)		Lus10014981 [exp]	93.7	0.5472
AT5G45140		NRPC2	nuclear RNA polymerase C2 (.1)		Lus10011322 [exp]	97.9	0.5956
AT4G12010			Disease resistance protein (TI...		Lus10018021 [exp]	109.5	0.5821
AT2G13680		GLS2, ATGSL02, ...	ARABIDOPSIS THALIANA GLUCAN SY...		Lus10033482 [exp]	131.2	0.5437

Compare expression of checked genes

Lus10007868 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.