Lus10007873 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62820 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G47670 99 / 1e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 79 / 3e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 71 / 5e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 66 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 66 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G20740 66 / 4e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 66 / 4e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23205 62 / 6e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 62 / 1e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030370 182 / 3e-55 AT4G02425 142 / 2e-43 unknown protein
Lus10038645 81 / 9e-19 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 72 / 1e-15 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 69 / 2e-14 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 69 / 3e-14 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 69 / 3e-14 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 67 / 9e-14 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 64 / 1e-12 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 64 / 2e-12 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G129400 172 / 2e-54 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 85 / 3e-20 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 85 / 3e-20 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 73 / 6e-16 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 73 / 7e-16 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G137800 71 / 3e-15 AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 71 / 4e-15 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 69 / 3e-14 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 69 / 3e-14 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 67 / 2e-13 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10007873 pacid=23143183 polypeptide=Lus10007873 locus=Lus10007873.g ID=Lus10007873.BGIv1.0 annot-version=v1.0
ATGAAAACTTCTGCGAGCATCATTACCATCATAAAGCTAATGTTGATTTCTTTTTCAGTGAGCTACTCCTCCTCGCCGAGCTCGTACGTGGAACAAGCTT
GCAGCGTGACCAAATACAAAGCCATCTGCATCCACTCCCTTGCACCATTCTCCCGCACTGCCAAGTCCAGCCCGAGCAAGTGGGCTCGAGCCGGAGTGTC
AGTGACCCTATCCGAGTCCAGCAACCTCACTCGCTTCCTCACCCACCTCCTAGCCGATTCTCCGTTCGGTTCGGGTAGCAGGAATCGCGCGGCTCTATCA
GACTGCTTGGAGTGCTTCCACGAAGCTGTCGATAGTCTCCATCTGTCGCTGGGAGTGGTGAGGAACTTGGAGGTGGCTAACTTCGACGCTCAGATGGATG
ACTTGACCACATGGCTCAGCGCTGCTTTGACGTACGGGGACACGTGCCTTGACGGGTTCGGTGACGGTGATGGTGATGTGGTTAAGAGGAGGAGGAAGAG
TGAAGTTGAGATGGTTAAGGGCAGAGTGAGGAGAGTTGGTTACATTACGAGTAATGCTTTGGCTCTTGTTAGCAGGCTTGCTTCTACTGGCTTAGAGGCT
ACCAAGCCAACTTGA
AA sequence
>Lus10007873 pacid=23143183 polypeptide=Lus10007873 locus=Lus10007873.g ID=Lus10007873.BGIv1.0 annot-version=v1.0
MKTSASIITIIKLMLISFSVSYSSSPSSYVEQACSVTKYKAICIHSLAPFSRTAKSSPSKWARAGVSVTLSESSNLTRFLTHLLADSPFGSGSRNRAALS
DCLECFHEAVDSLHLSLGVVRNLEVANFDAQMDDLTTWLSAALTYGDTCLDGFGDGDGDVVKRRRKSEVEMVKGRVRRVGYITSNALALVSRLASTGLEA
TKPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62820 Plant invertase/pectin methyle... Lus10007873 0 1
AT3G46450 SEC14 cytosolic factor family ... Lus10004952 2.2 0.8202
AT4G27940 ATMTM1 ARABIDOPSIS MANGANESE TRACKING... Lus10014940 2.8 0.8065
AT3G57990 unknown protein Lus10012013 6.5 0.7947
AT3G26430 GDSL-like Lipase/Acylhydrolase... Lus10036873 15.3 0.8050
AT2G37660 NAD(P)-binding Rossmann-fold s... Lus10024383 16.6 0.7294
AT5G11260 bZIP TED5, HY5 REVERSAL OF THE DET PHENOTYPE ... Lus10002028 16.8 0.7973
AT3G26430 GDSL-like Lipase/Acylhydrolase... Lus10006224 20.9 0.7976
AT3G23920 BAM1, BMY7, TR-... BETA-AMYLASE 7, beta-amylase 1... Lus10004396 21.8 0.7677
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10038866 24.7 0.7608
AT1G16810 unknown protein Lus10026960 25.3 0.7886

Lus10007873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.