Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62880 106 / 6e-31 ATOEP16-4 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G128900 [exp] 123 / 1e-37 AT3G62880 177 / 2e-58 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02466 [flax] [poplar] Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence Show only first row Show all	>Lus10007878 pacid=23143192 polypeptide=Lus10007878 locus=Lus10007878.g ID=Lus10007878.BGIv1.0 annot-version=v1.0 ATGGAGAAGGAGCTGATCGACGTCGCTCCCTGCTCCTCCCTAGCCGTCGACTCCATTCTCCGAGTAGGAACTGGAGGCCTCGTTTGGGGTTCTTGCATCG GTCCCTACGATGCAAGTCTTACTGGCGCTGCTCGGGCTTCTTATGTGGCAAAGGCAATCGGTGGGCACGGTTTCCGTTGTGGACTAATGGGAGGATGCTT CTCTATCACTCGTTGTGGACTTCAGAAGTACAGACAAAAGAATGACTGGGTTAGTTTAACTTCATATGATCGGTTTCTTCTGATTGCAACCCTTTTCATT ACTCTACATGATCATAATAACTCATAG
AA sequence Show only first row Show all	>Lus10007878 pacid=23143192 polypeptide=Lus10007878 locus=Lus10007878.g ID=Lus10007878.BGIv1.0 annot-version=v1.0 MEKELIDVAPCSSLAVDSILRVGTGGLVWGSCIGPYDASLTGAARASYVAKAIGGHGFRCGLMGGCFSITRCGLQKYRQKNDWVSLTSYDRFLLIATLFI TLHDHNNS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62880		ATOEP16-4	Mitochondrial import inner mem...		Lus10007878 [exp]	0	1
AT3G20250		APUM5	pumilio 5 (.1)		Lus10033353 [exp]	12.7	0.9015
AT1G18460			alpha/beta-Hydrolases superfam...		Lus10042972 [exp]	13.3	0.8889
AT5G58340	MYB		myb-like HTH transcriptional r...		Lus10020771 [exp]	14.1	0.8734
AT3G04600			Nucleotidylyl transferase supe...		Lus10018331 [exp]	25.9	0.8866
AT5G23090	CCAAT	NF-YB13	"nuclear factor Y, subunit B13...		Lus10027242 [exp]	29.4	0.8897
AT4G22920		ATNYE1, SGR1, S...	non-yellowing 1 (.1)		Lus10001194 [exp]	35.0	0.8744
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10012041 [exp]	37.3	0.8702
AT3G21700		ATSGP2	Ras-related small GTP-binding ...		Lus10039670 [exp]	56.7	0.8389
AT4G18880	HSF	AT-HSFA4A ,HSF ...	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10015237 [exp]	56.9	0.8626
AT3G06390			Uncharacterised protein family...		Lus10012808 [exp]	57.6	0.8680

Compare expression of checked genes

Lus10007878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.