Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17860 125 / 9e-37 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73260 98 / 7e-26 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) AT1G73325 92 / 1e-23 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73330 70 / 2e-15 ATDR4 drought-repressed 4 (.1) AT1G72290 43 / 2e-05 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030355 [exp] 320 / 5e-113 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039163 [exp] 226 / 4e-76 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013770 [exp] 224 / 2e-75 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007889 [exp] 219 / 1e-73 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013730 [exp] 214 / 1e-71 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039209 [exp] 213 / 2e-71 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039210 [exp] 213 / 3e-71 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013731 [exp] 216 / 7e-71 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1) Lus10030354 [exp] 213 / 1e-70 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G153400 [exp] 164 / 3e-52 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153466 [exp] 163 / 1e-51 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153600 [exp] 162 / 4e-51 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067900 [exp] 145 / 2e-44 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067600 [exp] 145 / 2e-44 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153200 [exp] 137 / 4e-41 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067800 [exp] 110 / 5e-31 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G006900 [exp] 56 / 3e-10 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) Potri.019G088200 [exp] 56 / 4e-10 AT1G73325 57 / 7e-10 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G124432 [exp] 56 / 7e-10 AT1G73325 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [flax] [poplar] Trefoil PF00197 [flax] [poplar] Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence Show only first row Show all	>Lus10007888 pacid=23143228 polypeptide=Lus10007888 locus=Lus10007888.g ID=Lus10007888.BGIv1.0 annot-version=v1.0 ATGGCCAGCTCAACAAACGACTCCACCACGTGCCCGCTCTCTGTCGTCCAGGACCCACACGAGGACTCGAGTGGGACCCCGCTGATGTTCCTCCCCGTGG CGACCAAAGTAGGGTACATGGTCCGCACGTCCACCGACCTTAACATAGAGTTCACCGCCGACGACACGGCCACCTGCGACGAGGGCAACGTGTGGAAGGT GGACGACTACGACGACGACGTGGAGCAGTGGTTCGTGGGGACCGGTGGGGTCGAAGGGAAGCCCGGTCCGAGGACGATCAACAACTGGTTCAAGATCGTG AAGTATGGAGGGAGTTACAAAGTGGCCTACTGTCCTGGAGTTTGTAAGTCGTGTAAGATTAAGTGTAAGGATGTTGGGTTGTTTGTTGATGAGAATGGGA CCAGGAGGCTTGCACTTACTGAAGATCACCCTTTTGTTGTTAGCTTCATGAAGGCTGATTAA
AA sequence Show only first row Show all	>Lus10007888 pacid=23143228 polypeptide=Lus10007888 locus=Lus10007888.g ID=Lus10007888.BGIv1.0 annot-version=v1.0 MASSTNDSTTCPLSVVQDPHEDSSGTPLMFLPVATKVGYMVRTSTDLNIEFTADDTATCDEGNVWKVDDYDDDVEQWFVGTGGVEGKPGPRTINNWFKIV KYGGSYKVAYCPGVCKSCKIKCKDVGLFVDENGTRRLALTEDHPFVVSFMKAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17860			Kunitz family trypsin and prot...		Lus10007888 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Lus10030355 [exp]	3.2	0.9472
AT5G57500			Galactosyltransferase family p...		Lus10019998 [exp]	5.4	0.9197
AT5G49190		ATSUS2, SSA, SU...	SUCROSE SYNTHASE FROM ARABIDOP...		Lus10010308 [exp]	11.3	0.9094
AT1G17860			Kunitz family trypsin and prot...		Lus10039210 [exp]	13.0	0.9469
AT1G45063			copper ion binding;electron ca...		Lus10006657 [exp]	17.7	0.9447
AT1G17860			Kunitz family trypsin and prot...		Lus10039209 [exp]	20.7	0.9267
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10021287 [exp]	22.5	0.9402
AT3G52450		PUB22	plant U-box 22 (.1)		Lus10029393 [exp]	23.5	0.9436
AT1G49310			unknown protein		Lus10040476 [exp]	25.0	0.9147
AT1G17860			Kunitz family trypsin and prot...		Lus10013730 [exp]	25.1	0.9334

Compare expression of checked genes

Lus10007888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.